From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005981000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 6042098..6042775
  • synteny block?: BlockID0047250
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2370
    08BA02176:
    C248_2482
    11819-97:
    MS7_2447
    71193:
    ST398NM01_2485
    ECT-R 2:
    ECTR2_2291
    ED133:
    SAOV_2483
    ED98:
    SAAV_2499
    HO 5096 0412:
    SAEMRSA15_23330
    JH1:
    SaurJH1_2508
    JH9:
    SaurJH9_2459
    JKD6008:
    SAA6008_02474
    JKD6159:
    SAA6159_02331
    LGA251:
    SARLGA251_22140
    M013:
    M013TW_2396
    MRSA252:
    SAR2523
    MSHR1132:
    SAMSHR1132_22610
    MSSA476:
    SAS2325
    Mu3:
    SAHV_2417
    Mu50:
    SAV2433
    MW2:
    MW2357
    RF122:
    SAB2315
    ST398:
    SAPIG2485
    T0131:
    SAT0131_02628
    TCH60:
    HMPREF0772_10755
    TW20:
    SATW20_25620
    USA300_TCH1516:
    USA300HOU_2419
    VC40:
    SAVC_11040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKRTDKYRDSYQYDNQNQNHRRQSEDASYRQQYAKGDPEEHPERYYNGRDYRREQILEEE
    N315            MKRTDKYRDSYQYDNQNQNHRRQSEDASYRQQYAKGDPEEHPERYYNGRDYRREQILEEE
    NCTC8325        MKRTDKYRDSYQYDNQNQNHRRQSEDASYRQQYAKGDPEEHPERYYNGRDYRREQILEEE
    Newman          MKRTDKYRDSYQYDNQNQNHRRQSEDASYRQQYAKGDPEEHPERYYNGRDYRREQILEEE
    USA300_FPR3757  MKRTDKYRDSYQYDNQNQNHRRQSEDASYRQQYAKGDPEEHPERYYNGRDYRREQILEEE
                    ************************************************************

    COL             NEKSRRSKKWLYIIIAILLIIVAIFVTRALLNNDSDKVSNDPKVSQNYKKQVENQDGQIN
    N315            NEKSRRSKKWLYIIIAILLIIVAIFVTRALLNNDSDKVSNDPKVSQNYKKQVENQDGQIN
    NCTC8325        NEKSRRSKKWLYIIIAILLIIVAIFVTRALLNNDSDKVSNDPKVSQNYKKQVENQDGQIN
    Newman          NEKSRRSKKWLYIIIAILLIIVAIFVTRALLNNDSDKVSNDPKVSQNYKKQVENQDGQIN
    USA300_FPR3757  NEKSRRSKKWLYIIIAILLIIVAIFVTRALLNNDSDKVSNDPKVSQNYKKQVENQDGQIN
                    ************************************************************

    COL             QQVDNAKENIKNNQKTDDIIKNLQNQIDNLKQQEQNKADSKLTQFYQDQINKLTEANNAL
    N315            QQVDNAKENIKNNQKTDDIIKNLQNQIDNLKQQEQNKADSKLTQFYQDQINKLTEANNAL
    NCTC8325        QQVDNAKENIKNNQKTDDIIKNLQNQIDNLKQQEQNKADSKLTQFYQDQINKLTEANNAL
    Newman          QQVDNAKENIKNNQKTDDIIKNLQNQIDNLKQQEQNKADSKLTQFYQDQINKLTEANNAL
    USA300_FPR3757  QQVDNAKENIKNNQKTDDIIKNLQNQIDNLKQQEQNKADSKLTQFYQDQINKLTEANNAL
                    ************************************************************

    COL             KNNASQGKIESMLNDINTKFDSIKSKLESLFKDDNGGAN
    N315            KNNASQGKIESMLNDINTKFDSIKSKLESLFKDDNGGAN
    NCTC8325        KNNASQGKIESMLNDINTKFDSIKSKLESLFKDDNGGAN
    Newman          KNNASQGKIESMLNDINTKFDSIKSKLESLFKDDNGGAN
    USA300_FPR3757  KNNASQGKIESMLNDINTKFDSIKSKLESLFKDDNGGAN
                    ***************************************