From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005986000
  • symbol?:
  • description?: amino acid ABC transporter

      descriptions from strain specific annotations:

    • amino acid ABC transporter
    • amino acid permease
    • D-serine/D-alanine/glycine transporter
    • amino acid ABC transporter-like protein
    • APC family amino acid-polyamine-organocation transporter
    • putative amino acid permease
    • D-alanine/D-serine/glycine permease
  • strand?: +
  • coordinates?: 6047248..6048657
  • synteny block?: BlockID0047300
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2375
    08BA02176:
    C248_2487
    11819-97:
    MS7_2452 (cycA)
    71193:
    ST398NM01_2490
    ECT-R 2:
    ECTR2_2296
    ED133:
    SAOV_2488
    ED98:
    SAAV_2504
    HO 5096 0412:
    SAEMRSA15_23380
    JH1:
    SaurJH1_2513
    JH9:
    SaurJH9_2464
    JKD6008:
    SAA6008_02479
    JKD6159:
    SAA6159_02336
    LGA251:
    SARLGA251_22190
    M013:
    M013TW_2401
    MRSA252:
    SAR2528
    MSHR1132:
    SAMSHR1132_22660
    MSSA476:
    SAS2330
    Mu3:
    SAHV_2422
    Mu50:
    SAV2438
    MW2:
    MW2362
    RF122:
    SAB2320
    ST398:
    SAPIG2490
    T0131:
    SAT0131_02635 (arcC)
    TCH60:
    HMPREF0772_10750 (cycA)
    TW20:
    SATW20_25670
    USA300_TCH1516:
    USA300HOU_2424
    VC40:
    SAVC_11065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MARKLHRELNNRHIQLIAIGGAIGTGLFLGSGQTISLTGPSLLFTYMIIGVVLFAFMRAL
    N315            MARKLHRELNNRHIQLIAIGGAIGTGLFLGSGQTISLTGPSLLFTYMIIGVVLFAFMRAL
    NCTC8325        MARKLHRELNNRHIQLIAIGGAIGTGLFLGSGQTISLTGPSLLFTYMIIGVVLFAFMRAL
    Newman          MARKLHRELNNRHIQLIAIGGAIGTGLFLGSGQTISLTGPSLLFTYMIIGVVLFAFMRAL
    USA300_FPR3757  MARKLHRELNNRHIQLIAIGGAIGTGLFLGSGQTISLTGPSLLFTYMIIGVVLFAFMRAL
                    ************************************************************

    COL             GELLLSNTRFNSFVDIANEYLGPFGGFVIGWTYWLCWIVSSMSDLTAMGQYFAFWYPQVP
    N315            GELLLSNTRFNSFVDIANEYLGPFGGFVIGWTYWLCWIVSSMSDLTAMGQYFAFWYPQVP
    NCTC8325        GELLLSNTRFNSFVDIANEYLGPFGGFVIGWTYWLCWIVSSMSDLTAMGQYFAFWYPQVP
    Newman          GELLLSNTRFNSFVDIANEYLGPFGGFVIGWTYWLCWIVSSMSDLTAMGQYFAFWYPQVP
    USA300_FPR3757  GELLLSNTRFNSFVDIANEYLGPFGGFVIGWTYWLCWIVSSMSDLTAMGQYFAFWYPQVP
                    ************************************************************

    COL             NWITVLFIVLILISFNLLGARLFGELEFWFSIIKVVTIIAMVIVGLVLIFFSFKTHYGHA
    N315            NWITVLFIVLILISFNLLGARLFGELEFWFSIIKVVTIIAMVIVGLVLIFFSFKTHYGHA
    NCTC8325        NWITVLFIVLILISFNLLGARLFGELEFWFSIIKVVTIIAMVIVGLVLIFFSFKTHYGHA
    Newman          NWITVLFIVLILISFNLLGARLFGELEFWFSIIKVVTIIAMVIVGLVLIFFSFKTHYGHA
    USA300_FPR3757  NWITVLFIVLILISFNLLGARLFGELEFWFSIIKVVTIIAMVIVGLVLIFFSFKTHYGHA
                    ************************************************************

    COL             SFTNLISHGGMFPGGTFGFLMSFQIAVYSFIGIELIGVTAGETKDPEKTLPKAINNVPIR
    N315            SFTNLISHGGMFPGGTFGFLMSFQIAVYSFIGIELIGVTAGETKDPEKTLPKAINNVPIR
    NCTC8325        SFTNLISHGGMFPGGTFGFLMSFQIAVYSFIGIELIGVTAGETKDPEKTLPKAINNVPIR
    Newman          SFTNLISHGGMFPGGTFGFLMSFQIAVYSFIGIELIGVTAGETKDPEKTLPKAINNVPIR
    USA300_FPR3757  SFTNLISHGGMFPGGTFGFLMSFQIAVYSFIGIELIGVTAGETKDPEKTLPKAINNVPIR
                    ************************************************************

    COL             ILLFYIGGLLVIMSVIPWNDIDPNSSPFVKLFTLIGVPFAAGVVNFVVLTAAASATNSGI
    N315            ILLFYIGGLLVIMSVIPWNDIDPNSSPFVKLFTLIGVPFAAGVVNFVVLTAAASATNSGI
    NCTC8325        ILLFYIGGLLVIMSVIPWNDIDPNSSPFVKLFTLIGVPFAAGVVNFVVLTAAASATNSGI
    Newman          ILLFYIGGLLVIMSVIPWNDIDPNSSPFVKLFTLIGVPFAAGVVNFVVLTAAASATNSGI
    USA300_FPR3757  ILLFYIGGLLVIMSVIPWNDIDPNSSPFVKLFTLIGVPFAAGVVNFVVLTAAASATNSGI
                    ************************************************************

    COL             YSNSRILFGLSQQGLGPKVLNKTNSHGVPYLSMLVSSIALLIAALLNYIFPNAIQLFIYV
    N315            YSNSRILFGLSQQGLGPKVLNWR-------------------------------ALFINV
    NCTC8325        YSNSRILFGLSQQGLGPKVLNKTNSHGVPYLSMLVSSIALLIAALLNYIFPNAIQLFIYV
    Newman          YSNSRILFGLSQQGLGPKVLNKTNSHGVPYLSMLVSSIALLIAALLNYIFPNAIQLFIYV
    USA300_FPR3757  YSNSRILFGLSQQGLGPKVLNKTNSHGVPYLSMLVSSIALLIAALLNYIFPNAIQLFIYV
                    *********************                                  *** *

    COL             TTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFF
    N315            SFINCITY-----------------------SSLVKL-----------------------
    NCTC8325        TTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFF
    Newman          TTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFF
    USA300_FPR3757  TTLSTVLFLVVWAMIIVAYLMYLKKHPEAHKNSKFKLIGGKPIAYIILAFFFFVFILLFF
                    : :. : :                       .* .**                       

    COL             SDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ
    N315            ------------------------------------------HF----P
    NCTC8325        SDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ
    Newman          SDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ
    USA300_FPR3757  SDETRAAIYISPFWFIFLFFFYKKYKTNAEKLAYEQRQNDSGHFRYDNQ
                                                              **