From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005988000
  • symbol?:
  • description?: Na_ antiporter-like protein

      descriptions from strain specific annotations:

    • Na_ antiporter-like protein
    • sodium/hydrogen exchanger
    • Na+/H+ antiporter, putative
    • sodium/hydrogen exchanger family protein
    • putative Na+/H+ antiporter
    • CPA1 family monovalent cation:proton (H+) antiporter-1
    • sodium hydrogen exchanger family protein
    • Na+/H+ antiporter family protein
  • strand?: +
  • coordinates?: 6048815..6050893
  • synteny block?: BlockID0047320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2376
    08BA02176:
    C248_2488
    11819-97:
    MS7_2453
    71193:
    ST398NM01_2491
    ECT-R 2:
    ECTR2_2297
    ED133:
    SAOV_2489
    ED98:
    SAAV_2505
    HO 5096 0412:
    SAEMRSA15_23390
    JH1:
    SaurJH1_2514
    JH9:
    SaurJH9_2465
    JKD6008:
    SAA6008_02480
    JKD6159:
    SAA6159_02337
    LGA251:
    SARLGA251_22200
    M013:
    M013TW_2402
    MRSA252:
    SAR2529
    MSHR1132:
    SAMSHR1132_22670
    MSSA476:
    SAS2331
    Mu3:
    SAHV_2423
    Mu50:
    SAV2439
    MW2:
    MW2363
    RF122:
    SAB2321
    ST398:
    SAPIG2491
    T0131:
    SAT0131_02636 (arcD)
    TCH60:
    HMPREF0772_10749
    TW20:
    SATW20_25680
    USA300_TCH1516:
    USA300HOU_2425
    VC40:
    SAVC_11070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALLEVFLIFIFAVIISSVINNRFPQIPTAFIQIALGVVIFIIPIQVDFQFNSEVFMFAV
    N315            MALLEAFLIFIFAVIISSVINNRFPQIPTAFIQIALGVVIFIIPIQVDFQFNSEVFMFAV
    NCTC8325        MALLEAFLIFIFAVIISSVINNRFPQIPTAFIQIALGVVIFIIPIQVDFQFNSEVFMFAV
    Newman          MALLEAFLIFIFAVIISSVINNRFPQIPTAFIQIALGVVIFIIPIQVDFQFNSEVFMFAV
    USA300_FPR3757  MALLEAFLIFIFAVIISSVINNRFPQIPTAFIQIALGVVIFIIPIQVDFQFNSEVFMFAV
                    *****.******************************************************

    COL             IAPLLFVEGTHVSRTKLLEYRKPILLMSMALVFATVVGVGYFIHWIWPALPMPAAFAIAA
    N315            IAPLLFVEGTHVSRTKLLEYRKPILLMSMALVFATVVGVGYFIHWIWPALPMPAAFAIAA
    NCTC8325        IAPLLFVEGTHVSRTKLLEYRKPILLMSMALVFATVVGVGYFIHWIWPALPMPAAFAIAA
    Newman          IAPLLFVEGTHVSRTKLLEYRKPILLMSMALVFATVVGVGYFIHWIWPALPMPAAFAIAA
    USA300_FPR3757  IAPLLFVEGTHVSRTKLLEYRKPILLMSMALVFATVVGVGYFIHWIWPALPMPAAFAIAA
                    ************************************************************

    COL             ILCPTDAVAVSAITRGKLLPKGSMTILEGESLLNDAAGIISFKIAVTALVTGTFSLFQAV
    N315            ILCPTDAVAVSAITRGKLLPKGSMTILEGESLLNDAAGIISFKIAVTALVTGTFSLFQAV
    NCTC8325        ILCPTDAVAVSAITRGKLLPKGSMTILEGESLLNDAAGIISFKIAVTALVTGTFSLFQAV
    Newman          ILCPTDAVAVSAITRGKLLPKGSMTILEGESLLNDAAGIISFKIAVTALVTGTFSLFQAV
    USA300_FPR3757  ILCPTDAVAVSAITRGKLLPKGSMTILEGESLLNDAAGIISFKIAVTALVTGTFSLFQAV
                    ************************************************************

    COL             EQFIISTILGVLIGAIIGFVVVRIRIDLTANKGLKDNNTLTFIQLLTPFVVYFLAEEVHA
    N315            EQFIISTILGVLIGAIIGFVVVRIRIDLTANKGLKDNNTLTFIQLLTPFVVYFLAEEVHA
    NCTC8325        EQFIISTILGVLIGAIIGFVVVRIRIDLTANKGLKDNNTLTFIQLLTPFVVYFLAEEVHA
    Newman          EQFIISTILGVLIGAIIGFVVVRIRIDLTANKGLKDNNTLTFIQLLTPFVVYFLAEEVHA
    USA300_FPR3757  EQFIISTILGVLIGAIIGFVVVRIRIDLTANKGLKDNNTLTFIQLLTPFVVYFLAEEVHA
                    ************************************************************

    COL             SGIIAVVIAGLIHGLERDRLIRAQTELQMNYHQIWNTFSYALNGFVFVVLGFMIPTVVID
    N315            SGIIAVVIAGLIHGLERDRLIRAQTELQMNYHQIWNTFSYALNGFVFVVLGFMIPTVVID
    NCTC8325        SGIIAVVIAGLIHGLERDRLIRAQTELQMNYHQIWNTFSYALNGFVFVVLGFMIPTVVID
    Newman          SGIIAVVIAGLIHGLERDRLIRAQTELQMNYHQIWNTFSYALNGFVFVVLGFMIPTVVID
    USA300_FPR3757  SGIIAVVIAGLIHGLERDRLIRAQTELQMNYHQIWNTFSYALNGFVFVVLGFMIPTVVID
                    ************************************************************

    COL             IFQTEPDNFSFLIVITILIAIAIYACRFVWVYFWYKDFYFPKNIQSYLDEEHDSHETPPS
    N315            IFQTEPDNFSFLIVITILIAIAIYACRFVWVYFWYKDFYFPKNIQSYLDEEHDSHETPPS
    NCTC8325        IFQTEPDNFSFLIVITILIAIAIYACRFVWVYFWYKDFYFPKNIQSYLDEEHDSHETPPS
    Newman          IFQTEPDNFSFLIVITILIAIAIYACRFVWVYFWYKDFYFPKNIQSYLDEEHDSHETPPS
    USA300_FPR3757  IFQTEPDNFSFLIVITILIAIAIYACRFVWVYFWYKDFYFPKNIQSYLDEEHDSHETPPS
                    ************************************************************

    COL             RVRYAFIMTMCGIHGTISLSMALTLPFIITKGQAFEYRNDLLFIASFMVLISLILAQIVL
    N315            RVRYAFIMTMCGIHGTISLSMALTLPFIITKGQAFEYRNDLLFIASFMVLISLILAQIVL
    NCTC8325        RVRYAFIMTMCGIHGTISLSMALTLPFIITKGQAFEYRNDLLFIASFMVLISLILAQIVL
    Newman          RVRYAFIMTMCGIHGTISLSMALTLPFIITKGQAFEYRNDLLFIASFMVLISLILAQIVL
    USA300_FPR3757  RVRYAFIMTMCGIHGTISLSMALTLPFIITKGQAFEYRNDLLFIASFMVLISLILAQIVL
                    ************************************************************

    COL             PLITPSAEDTTFKGMTYQSAKIFIVQKVIQHFKNESKKDKNDTNYRPVLNQYYGELLFLL
    N315            PLITPSAEDTTFKGMTYQSAKIFIVQKVIQHFKNESKKDKNDTNYRPVLNQYYGELLFLL
    NCTC8325        PLITPSAEDTTFKGMTYQSAKIFIVQKVIQHFKNESKKDKNDTNYRPVLNQYYGELLFLL
    Newman          PLITPSAEDTTFKGMTYQSAKIFIVQKVIQHFKNESKKDKNDTNYRPVLNQYYGELLFLL
    USA300_FPR3757  PLITPSAEDTTFKGMTYQSAKIFIVQKVIQHFKNESKKDKNDTNYRPVLNQYYGELLFLL
                    ************************************************************

    COL             NSEPDNQNTKELKRLEDIAKVIETSTLERLIDKGKATYQDINNYRNIVELTETHRTASFV
    N315            NSEPNNQNTKELKRLEDIAKVIETSTLERLIDKGKATYQDINNYRNIVELTETHRTASFV
    NCTC8325        NSEPDNQNTKELKRLEDIAKVIETSTLERLIDKGKATYQDINNYRNIVELTETHRTASFV
    Newman          NSEPDNQNTKELKRLEDIAKVIETSTLERLIDKGKATYQDINNYRNIGELTETPRTASFG
    USA300_FPR3757  NSEPDNQNTKELKRLEDIAKVIETSTLERLIDKGKATYQDINNYRNIVELTETHRTASFV
                    ****:****************************************** ***** ***** 

    COL             EKFANFFKMLWLRLKAMKHYKALNKESKKQEFENSFKDVQKIMRIVNHNIILRLKEEQNS
    N315            EKFANFFKMLWLRLKAMKHYKALNKESKKQEFENSFKDVQKIMRIVNHNIILRLKEEQNS
    NCTC8325        EKFANFFKMLWLRLKAMKHYKALNKESKKQEFENSFKDVQKIMRIVNHNIILRLKEEQNS
    Newman          EKFANFFQMLWLKLKAMKHYKALNKESKKQEFENSFKDVQKIMRIVNHNIILRLKEEQNS
    USA300_FPR3757  EKFANFFKMLWLRLKAMKHYKALNKESKKQEFENSFKDVQKIMRIVNHNIILRLKEEQNS
                    *******:****:***********************************************

    COL             TNVLEVSLVINHYYDMSRSLKWRAQRRKERQENSNQIIPQAMFHNHKLEALYLQRHLLDE
    N315            TNVLEVSLVINHYYDMSRSLKWRAQRRKERQENSNQIIPQAMFHNHKLEALYLQRHLLDE
    NCTC8325        TNVLEVSLVINHYYDMSRSLKWRAQRRKERQENSNQIIPQAMFHNHKLEALYLQRHLLDE
    Newman          TNVLEVSLVINHYYDMSRSLKWRAQRRKERQENSNQIIPQAMFHNHKLEALYLQRHLLDE
    USA300_FPR3757  TNVLEVSLVINHYYDMSRSLKWRAQRRKERQENSNQIIPQAMFHNHKLEALYLQRHLLDE
                    ************************************************************

    COL             LIRKNKINNIVAAQIRENINYNEIVLSLQSKH
    N315            LIRKNKINNIVAAQIRENINYNEIVLSLQSKH
    NCTC8325        LIRKNKINNIVAAQIRENINYNEIVLSLQSKH
    Newman          LIRKNKINNIVAAQIRENINYNEIVLSLQSKH
    USA300_FPR3757  LIRKNKINNIVAAQIRENINYNEIVLSLQSKH
                    ********************************