From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005992000
  • symbol?: flp
  • description?: fmtA-like protein

      descriptions from strain specific annotations:

    • fmtA-like protein
    • beta-lactamase
    • beta-lactamase family protein
    • fmtA-like beta-lactam resistance protein
    • FmtA protein
    • drug resistance-involved membrane protein
    • Protein flp
  • strand?: +
  • coordinates?: 6053105..6054601
  • synteny block?: BlockID0047360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2378
    08BA02176:
    C248_2490
    11819-97:
    MS7_2455
    71193:
    ST398NM01_2493
    ECT-R 2:
    ECTR2_2299
    ED133:
    SAOV_2491
    ED98:
    SAAV_2507
    HO 5096 0412:
    SAEMRSA15_23410
    JH1:
    SaurJH1_2516
    JH9:
    SaurJH9_2468
    JKD6008:
    SAA6008_02482 (ampC)
    JKD6159:
    SAA6159_02339 (ampC)
    LGA251:
    SARLGA251_22220
    M013:
    M013TW_2404
    MRSA252:
    SAR2531
    MSHR1132:
    SAMSHR1132_22690
    MSSA476:
    SAS2333
    Mu3:
    SAHV_2425
    Mu50:
    SAV2441
    MW2:
    MW2365
    RF122:
    SAB2323
    ST398:
    SAPIG2493
    T0131:
    SAT0131_02639 (arcB)
    TCH60:
    HMPREF0772_10747
    TW20:
    SATW20_25700
    USA300_TCH1516:
    USA300HOU_2429 (fmtA)
    VC40:
    SAVC_11080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTKKLYFLSISIIIIVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS
    N315            MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDKIIEHDLQKGHIPGAS
    NCTC8325        MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS
    Newman          MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS
    USA300_FPR3757  MTTKKLYFLSISIIILVAISIAIYITLNSNTKTRLTNDSQQQIDTIIEHDLQKGHIPGAS
                    ***************:****************************.***************

    COL             ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA
    N315            ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDD
    NCTC8325        ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA
    Newman          ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA
    USA300_FPR3757  ILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDA
                    *********************************************************** 

    COL             VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTRAIMGDEL
    N315            VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDEL
    NCTC8325        VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTHAIMGDEL
    Newman          VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTRAIMGDEL
    USA300_FPR3757  VSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDSVTSKNNRLNDVTRAIMGDEL
                    ***************************************:**.*********:*******

    COL             HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA
    N315            HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNNKSKHDA
    NCTC8325        HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA
    Newman          HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA
    USA300_FPR3757  HHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNYKSKHDA
                    ***************************************************** ******

    COL             IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS
    N315            IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS
    NCTC8325        IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS
    Newman          IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS
    USA300_FPR3757  IGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLS
                    ************************************************************

    COL             STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK
    N315            STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK
    NCTC8325        STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK
    Newman          STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK
    USA300_FPR3757  STIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPK
                    ************************************************************

    COL             LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL
    N315            LVEHLNTQIVNHKRYSTVASILNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL
    NCTC8325        LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL
    Newman          LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL
    USA300_FPR3757  LVEHLNTQIVNHKRYSTVASMLNQYKDQFNIVTVLMTTLILLAFIFSAYRAWQMRHGQIL
                    ********************:***************************************

    COL             LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL
    N315            LRRSKRIAVLSWLTLCLCIAIALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL
    NCTC8325        LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL
    Newman          LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL
    USA300_FPR3757  LRRSKRIAVLSWLSLCICIALALILYALPYLILGSNNWSFVLTWLPIEIKLALITTLIAL
                    *************:**:***:***************************************

    COL             FSTLIVILLFLHTKITKT
    N315            FSTLIVILLFLHTKITKT
    NCTC8325        FSTLIVILLFLHTKITKT
    Newman          FSTLIVILLFLHTKITKT
    USA300_FPR3757  FSTLIVILLFLHTKITKT
                    ******************