From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005993000
  • symbol?:
  • description?: dTDP-glucose 4,6-dehydratase

      descriptions from strain specific annotations:

    • dTDP-glucose 4,6-dehydratase
    • NAD-dependent epimerase/dehydratase
    • NAD dependent epimerase/dehydratase family protein
    • epimerase/dehydratase, putative
    • polysaccharide biosynthesis family protein
    • putative NAD-dependent epimerase/dehydratase
  • strand?: -
  • coordinates?: 6054747..6055598
  • synteny block?: BlockID0047370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2379
    08BA02176:
    C248_2491
    11819-97:
    MS7_2456
    71193:
    ST398NM01_2494
    ECT-R 2:
    ECTR2_2300
    ED133:
    SAOV_2492c
    ED98:
    SAAV_2508
    HO 5096 0412:
    SAEMRSA15_23420
    JH1:
    SaurJH1_2517
    JH9:
    SaurJH9_2469
    JKD6008:
    SAA6008_02483
    JKD6159:
    SAA6159_02340
    LGA251:
    SARLGA251_22230
    M013:
    M013TW_2405
    MRSA252:
    SAR2532
    MSHR1132:
    SAMSHR1132_22700
    MSSA476:
    SAS2334
    Mu3:
    SAHV_2426
    Mu50:
    SAV2442
    MW2:
    MW2366
    RF122:
    SAB2324c
    ST398:
    SAPIG2494
    T0131:
    SAT0131_02640 (fabG)
    TCH60:
    HMPREF0772_10746
    TW20:
    SATW20_25710
    USA300_TCH1516:
    USA300HOU_2430
    VC40:
    SAVC_11085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKIFVTGATGLIGIKLVQRLKEEGHEVAGFTTSENGQQKLAAVNVKAYIGDILKADTID
    N315            MSKIFVTGATGLIGIKLVQRLKEEGHEVAGFTTSENGQQKLAAINVKAYIGDILKADTID
    NCTC8325        MSKIFVTGATGLIGIKLVQRLKEEGHEVAGFTTSENGQQKLAAVNVKAYIGDILKADTID
    Newman          MSKIFVTGATGLIGIKLVQRLKEEGHEVAGFTTSENGQQKLAAVNVKAYIGDILKADTID
    USA300_FPR3757  MSKIFVTGATGLIGIKLVQRLKEEGHEVAGFTTSENGQQKLAAVNVKAYIGDILKADTID
                    *******************************************:****************

    COL             QALADFKPEIIINQITDLKNVDMAANTKVRIEGSKNLIDAAKKHDVKKVIAQSIAFMYEP
    N315            QALADFKPEIIINQITDLKNVDMAANTKVRIEGSKNLIDAAKKHDVKKVIAQSIAFMYEP
    NCTC8325        QALADFKPEIIINQITDLKNVDMAANTKVRIEGSKNLIDAAKKHDVKKVIAQSIAFMYEP
    Newman          QALADFKPEIIINQITDLKNVDMAANTKVRIEGSKNLIDAAKKHDVKKVIAQSIAFMYEP
    USA300_FPR3757  QALADFKPEIIINQITDLKNVDMAANTKVRIEGSKNLIDAAKKHDVKKVIAQSIAFMYEP
                    ************************************************************

    COL             GEGLANEETSLDFNSTGDRKVTVDGVVGLEEETARMDEYVVLRFGWLYGPGTWYGKDGMI
    N315            GEGLANEETSLDFNSTGDRKVTVDGVVGLEEETARMDEYVVLRFGWLYGPGTWYGKDGMI
    NCTC8325        GEGLANEETSLDFNSTGDRKVTVDGVVGLEEETARMDEYVVLRFGWLYGPGTWYGKDGMI
    Newman          GEGLANEETSLDFNSTGDRKVTVDGVVGLEEETARMDEYVVLRFGWLYGPGTWYGKDGMI
    USA300_FPR3757  GEGLANEETSLDFNSTGDRKVTVDGVVGLEEETARMDEYVVLRFGWLYGPGTWYGKDGMI
                    ************************************************************

    COL             YNQFMDGQVTLSDGVTSFVHLDDAVETSIQAIHFENGIYNVADDAPVKGSEFAEWYKEQL
    N315            YNQFMDGQVTLSDGVTSFVHLDDAVETSIQAIHFENGIYNVADDAPVKGSEFAEWYKEQL
    NCTC8325        YNQFMDGQVTLSDGVTSFVHLDDAVETSIQAIHFENGIYNVADDAPVKGSEFAEWYKEQL
    Newman          YNQFMDGQVTLSDGVTSFVHLDDAVETSIQAIHFENGIYNVADDAPVKGSEFAEWYKEQL
    USA300_FPR3757  YNQFMDGQVTLSDGVTSFVHLDDAVETSIQAIHFENGIYNVADDAPVKGSEFAEWYKEQL
                    ************************************************************

    COL             GVEPNIDIQPAQPFERGVSNEKFKAQGGTLIYQTWKDGMNPIK
    N315            GVEPNIDIQPAQPFERGVSNEKFKAQGGTLIYKTWKDGMNPIK
    NCTC8325        GVEPNIDIQPAQPFERGVSNEKFKAQGGTLIYQTWKDGMNPIK
    Newman          GVEPNIDIQPAQPFERGVSNEKFKAQGGTLIYQTWKDGMNPIK
    USA300_FPR3757  GVEPNIDIQPAQPFERGVSNEKFKAQGGTLIYQTWKDGMNPIK
                    ********************************:**********