From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005999000
  • symbol?: opuCB
  • description?: glycine betaine/carnitine/choline ABC transporter opuCB

      descriptions from strain specific annotations:

    • glycine betaine/carnitine/choline ABC transporter opuCB
    • binding-protein-dependent transport system inner membrane protein
    • amino acid ABC transporter permease
    • OsmotiCALL import_20_25_26_pangenomey activated L-carnitine/choline ABC transporter, permease protein OpuCB
    • glycine betaine/carnitine/choline transport system permease OpuCB
    • glycine betaine/choline ABC transporter membrane protein
    • putative glycine betaine/carnitine/cholinetransport system permease protein
    • glycine betaine/choline ABC superfamily ATP binding cassette transporter, membrane protein
    • binding--dependent transport system inner membrane component family protein
    • betaine-carnitine-choline ABC transporter
    • glycine betaine/carnitine/choline ABC transporter permease
    • glycine betaine/L-proline ABC superfamily ATP binding cassette transporter, membrane protein
    • glycine betaine/carnitine/choline transport system permease protein opuCB
  • strand?: -
  • coordinates?: 6060925..6061560
  • synteny block?: BlockID0047430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2236 (opuCB)
    NCTC8325:
    Newman:
    NWMN_2346 (opuCB)
    USA300_FPR3757:
    SAUSA300_2392 (opuCb)
    04-02981:
    SA2981_2384 (opuCB)
    08BA02176:
    C248_2497 (opuCB)
    11819-97:
    MS7_2461
    71193:
    ST398NM01_2499
    ECT-R 2:
    ECTR2_2305
    ED133:
    SAOV_2497c
    ED98:
    SAAV_2513
    HO 5096 0412:
    SAEMRSA15_23470 (opuCB)
    JH1:
    SaurJH1_2522
    JH9:
    SaurJH9_2474
    JKD6008:
    SAA6008_02489 (opuCB)
    JKD6159:
    SAA6159_02345 (opuCB)
    LGA251:
    SARLGA251_22280 (opuCB)
    M013:
    M013TW_2410
    MRSA252:
    SAR2537 (opuCB)
    MSHR1132:
    SAMSHR1132_22750
    MSSA476:
    SAS2339
    Mu3:
    SAHV_2431 (opuCB)
    Mu50:
    SAV2447 (opuCB)
    MW2:
    MW2371 (opuCB)
    RF122:
    SAB2329c (opuCB)
    ST398:
    SAPIG2499
    T0131:
    SAT0131_02646
    TCH60:
    HMPREF0772_10741 (opuCB)
    TW20:
    SATW20_25760 (opuCB)
    USA300_TCH1516:
    USA300HOU_2436
    VC40:
    SAVC_11110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIEFLHEHGGQLMSKTLEHFYISIVALLLAIIVAVPIGILLSKTKRTANIVLTVAGVLQT
    N315            MIEFLHEHGGQLMSKTLEHFYISIVALLLAIIVAVPIGILLSKTKRTANIVLTVAGVLQT
    NCTC8325        MIEFLHEHGGQLMSKTLEHFYISIVALLLAIIVAVPIGILLSKTKRTANIVLTVAGVLQT
    Newman          MIEFLHEHGGQLMSKTLEHFYISIVALLLAIIVAVPIGILLSKTKRTANIVLTVAGVLQT
    USA300_FPR3757  MIEFLHEHGGQLMSKTLEHFYISIVALLLAIIVAVPIGILLSKTKRTANIVLTVAGVLQT
                    ************************************************************

    COL             IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVQNIDSNIKEAGKSMGMTQF
    N315            IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVQNIDSNIKEAGKSMGMTQF
    NCTC8325        IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVQNIDSNIKEAGKSMGMTQF
    Newman          IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVQNIDSNIKEAGKSMGMTQF
    USA300_FPR3757  IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVQNIDSNIKEAGKSMGMTQF
                    ************************************************************

    COL             QLMKDVELPLALPLIIGGIRLSSVYVISWATLASYVGAGGLGDFIFNGLNLYDPLMIVTA
    N315            QLMKDVELPLALPLIIGGIRLSSVYVISWATLASYVGAGGLGDFIFNGLNLYDPLMIVTA
    NCTC8325        QLMKDVELPLALPLIIGGIRLSSVYVISWATLASYVGAGGLGDFIFNGLNLYDPLMIVTA
    Newman          QLMKDVELPLALPLIIGGIRLSSVYVISWATLASYVGAGGLGDFIFNGLNLYDPLMIVTA
    USA300_FPR3757  QLMKDVELPLALPLIIGGIRLSSVYVISWATLASYVGAGGLGDFIFNGLNLYDPLMIVTA
                    ************************************************************

    COL             TVLVTALALGVDALLALVEKWVVPKGLKVSG
    N315            TVLVTALALGVDALLALVEKWVVPKGLKVSG
    NCTC8325        TVLVTALALGVDALLALVEKWVVPKGLKVSG
    Newman          TVLVTALALGVDALLALVEKWVVPKGLKVSG
    USA300_FPR3757  TVLVTALALGVDALLALVEKWVVPKGLKVSG
                    *******************************