From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2346 [new locus tag: NWMN_RS13515 ]
  • pan locus tag?: SAUPAN005999000
  • symbol: opuCB
  • pan gene symbol?: opuCB
  • synonym:
  • product: amino acid ABC transporter permease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2346 [new locus tag: NWMN_RS13515 ]
  • symbol: opuCB
  • product: amino acid ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2580206..2580841
  • length: 636
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATTGAGTTCCTACATGAACATGGTGGACAGTTGATGTCGAAAACACTGGAACATTTC
    TATATTTCTATAGTGGCATTATTACTTGCCATCATTGTTGCAGTACCTATAGGCATTTTA
    TTATCAAAAACAAAGCGAACTGCCAATATTGTATTAACTGTGGCAGGTGTCTTACAAACT
    ATTCCAACACTAGCTGTACTTGCTATTATGATACCGATTTTTGGTGTTGGTAAAACGCCT
    GCAATTGTAGCGCTATTTATTTATGTATTATTACCTATTTTAAATAACACGGTACTCGGT
    GTTCAAAATATTGATAGCAACATTAAAGAAGCTGGAAAAAGTATGGGAATGACACAATTT
    CAATTGATGAAGGATGTTGAATTGCCGTTAGCATTGCCGCTTATCATTGGTGGCATTCGT
    TTGTCATCTGTGTATGTAATTAGTTGGGCTACACTTGCAAGTTATGTAGGTGCGGGTGGA
    TTAGGTGATTTCATTTTCAATGGTTTAAATTTATATGATCCACTGATGATTGTAACTGCA
    ACGGTACTCGTTACTGCACTAGCATTAGGTGTTGATGCCTTATTAGCTTTAGTTGAAAAA
    TGGGTAGTTCCCAAAGGCTTAAAAGTATCTGGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    636

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2346 [new locus tag: NWMN_RS13515 ]
  • symbol: OpuCB
  • description: amino acid ABC transporter permease
  • length: 211
  • theoretical pI: 8.84699
  • theoretical MW: 22385.9
  • GRAVY: 1.03744

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    choline ABC transporter, permease protein (TIGR03416; HMM-score: 95.1)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, permease protein (TIGR01183; HMM-score: 60.2)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 49.2)
    NifC-like ABC-type porter (TIGR01581; HMM-score: 25.9)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 23.4)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 21.8)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, permease protein (TIGR02141; HMM-score: 19.9)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 16.4)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuD (TIGR03003; HMM-score: 10.1)
  • TheSEED:  
    Choline and Betaine Uptake and Betaine Biosynthesis Choline ABC transport system, permease protein OpuBB 
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 79.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 49
    • Cmax: 0.145
    • Cmax_pos: 43
    • Smax: 0.167
    • Smax_pos: 45
    • Smean: 0.075
    • D: 0.107
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIEFLHEHGGQLMSKTLEHFYISIVALLLAIIVAVPIGILLSKTKRTANIVLTVAGVLQTIPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVQNIDSNIKEAGKSMGMTQFQLMKDVELPLALPLIIGGIRLSSVYVISWATLASYVGAGGLGDFIFNGLNLYDPLMIVTATVLVTALALGVDALLALVEKWVVPKGLKVSG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]