From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2347 [new locus tag: NWMN_RS13520 ]
  • pan locus tag?: SAUPAN006000000
  • symbol: opuCA
  • pan gene symbol?: opuCA
  • synonym:
  • product: glycine betaine/L-proline transport ATP-binding subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2347 [new locus tag: NWMN_RS13520 ]
  • symbol: opuCA
  • product: glycine betaine/L-proline transport ATP-binding subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2580838..2582064
  • length: 1227
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGTTAAGTATTAAGCATTTAACGAAAATTTATTCTGGTAATAAAAAGGCAGTAGATGAC
    ATCTCTTTAGATATTCAATCTGGGGAATTTATCGCATTTATTGGAACCAGTGGAAGTGGC
    AAAACGACTGCTTTAAGAATGATAAACCGTATGATTGAAGCGACAGAAGGACAAATTGAA
    ATTGATGGTAAAGATGTTCGGAGTATGAATCCTGTCGAATTGCGTAGAAATATTGGCTAT
    GTTATTCAACAAATTGGCTTAATGCCTCATATGACGATTAAAGAGAATATTGTGTTGGTA
    CCCAAATTGTTGAAATGGACTAAAGAGGAAAAGGATAAACGTGCAAAGGAATTAATTAAA
    CTTGTGGATTTACCGGAGTCATTTTTAGAGCGTTATCCAGCAGAACTATCAGGTGGGCAA
    CAACAACGTATCGGTGTTGTAAGAGCACTTGCGGCCGAACAAGATATTATTTTAATGGAT
    GAACCTTTTGGTGCATTGGATCCTATTACGAGAGATACGTTACAAGATTTAGTTAAAACG
    TTACAACGAAAATTAGGCAAGACGTTTATCTTTGTAACACATGATATGGATGAAGCGATT
    AAATTAGCAGACAAAATTTGTATTATGTCAGAAGGTAAGGTGGTGCAATTTGATACGCCA
    GACAATATTTTAAGACATCCCGCAAATGATTTTGTACGTGATTTTATAGGACAAAATAGA
    CTGATTCAAGACCGTCCCAATGACAAGACTGTAGAAGGTGTAATGATTAAACCAATCACG
    ATACAAGCAGAAGCAACACTGAATGACGCCGTTCATATTATGAGACAAAAACGTGTTGAT
    ACTATTTTTGTAGTAGATAGTAATAACCATTTACTAGGTTTCTTAGACATTGAAGATATA
    AATCAGGGTATACGTGGACACAAAAGTTTACGAGACACCATGCAACAACATATTTATACC
    GTTCAAATTGATTCTAAATTACAAGATTCTGTACGTACGATTTTAAAAAGAAACGTTAGG
    AATGTACCTGTCGTAGATGATCAACAGCGTTTAGTAGGACTGATTACGCGTGCCAATGTT
    GTTGATATTGTATATGACACGATTTGGGGCGATAGTGAGGATACAGTGCAAACAGAACAT
    GTGGGGGAAGACACTGCGTCCTCAAAAGTGCATGAGCAACACACTACTAATGTCAAAGTA
    CGTGACATAGGAGATGATAAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1227

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2347 [new locus tag: NWMN_RS13520 ]
  • symbol: OpuCA
  • description: glycine betaine/L-proline transport ATP-binding subunit
  • length: 408
  • theoretical pI: 6.15286
  • theoretical MW: 46173.6
  • GRAVY: -0.347549

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesglycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 457.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesputative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 246.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescholine ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 244.9)
    MetabolismTransport and binding proteinsAnionssulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 232)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminespolyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 224.7)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 202)
    MetabolismTransport and binding proteinsAnionsphosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 192)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 190.5)
    MetabolismTransport and binding proteinsAnionsphosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 177.3)
    MetabolismTransport and binding proteinsOtherdaunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 175.7)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 170.5)
    MetabolismTransport and binding proteinsUnknown substrateenergy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 166)
    Cellular processesCellular processesCell divisioncell division ATP-binding protein FtsE (TIGR02673; HMM-score: 159.2)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 155.2)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 155.2)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 154.9)
    MetabolismTransport and binding proteinsAnionsnitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 153.2)
    MetabolismTransport and binding proteinsOthernitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 153.2)
    MetabolismTransport and binding proteinsAnionsmolybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 152)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 148.7)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 147.8)
    Cellular processesCellular processesPathogenesistype I secretion system ATPase (TIGR03375; HMM-score: 147.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR03375; HMM-score: 147.8)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 146.5)
    MetabolismTransport and binding proteinsOtherLPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 146.5)
    MetabolismTransport and binding proteinsOtherthiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 146)
    Genetic information processingProtein fateProtein and peptide secretion and traffickinglipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 144.9)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 139.5)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 136.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 135.7)
    MetabolismEnergy metabolismMethanogenesismethyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 133.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 131.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01842; HMM-score: 126.3)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 126.1)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 123.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharideslipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 122.9)
    MetabolismTransport and binding proteinsOtherlipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 122.9)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 121)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 121)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 119.2)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 114.1)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 114)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 114)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 112.7)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)
    Genetic information processingProtein fateProtein modification and repairABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)
    MetabolismTransport and binding proteinsOtherABC-type bacteriocin transporter (TIGR01193; HMM-score: 108.5)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 108.2)
    Cellular processesCellular processesOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 106.1)
    MetabolismTransport and binding proteinsOthernodulation ABC transporter NodI (TIGR01288; HMM-score: 106.1)
    MetabolismTransport and binding proteinsUnknown substrateanchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 105.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 102.2)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 99.6)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesurea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 99.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 97)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsglucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 95.4)
    MetabolismTransport and binding proteinsOtherrim ABC transporter (TIGR01257; HMM-score: 94)
    MetabolismTransport and binding proteinsOtherantigen peptide transporter 2 (TIGR00958; HMM-score: 91.2)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.6)
    MetabolismTransport and binding proteinsOtherheme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.6)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 84.2)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 80.9)
    MetabolismTransport and binding proteinsAnionscystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 76.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherFeS assembly ATPase SufC (TIGR01978; HMM-score: 62.9)
    MetabolismTransport and binding proteinsOthermulti drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 61.7)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminescyclic peptide transporter (TIGR01194; HMM-score: 58.5)
    MetabolismTransport and binding proteinsOthercyclic peptide transporter (TIGR01194; HMM-score: 58.5)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 54.6)
    MetabolismTransport and binding proteinsOtherpleiotropic drug resistance family protein (TIGR00956; HMM-score: 47.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisinosine-5'-monophosphate dehydrogenase (TIGR01302; EC 1.1.1.205; HMM-score: 45.4)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairexcinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 41.6)
    MetabolismEnergy metabolismSugarssugar isomerase, KpsF/GutQ family (TIGR00393; HMM-score: 36.7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmagnesium transporter (TIGR00400; HMM-score: 35.5)
    Unknown functionGeneralIMP dehydrogenase family protein (TIGR01303; HMM-score: 25.5)
    MetabolismAmino acid biosynthesisSerine familycystathionine beta-synthase (TIGR01137; EC 4.2.1.22; HMM-score: 24.3)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsperoxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 20.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 13.4)
    MetabolismCentral intermediary metabolismSulfur metabolismadenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13)
  • TheSEED:  
    Stress ResponseOsmotic stressCholine and Betaine Uptake and Betaine Biosynthesis Osmotically activated L-carnitine/choline ABC transporter, ATP-binding protein OpuCA 
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 115.5)
    no clan definedCBS; CBS domain (PF00571; HMM-score: 61.5)
    P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 27.3)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 21.7)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 19.3)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 18.5)
    NTPase_1; NTPase (PF03266; HMM-score: 17.9)
    AAA_22; AAA domain (PF13401; HMM-score: 17.5)
    AAA_30; AAA domain (PF13604; HMM-score: 17.2)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 16.8)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 15.4)
    AAA_18; AAA domain (PF13238; HMM-score: 15)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 14.8)
    AAA_28; AAA domain (PF13521; HMM-score: 14.4)
    SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.142
    • Ymax_pos: 11
    • Cmax: 0.151
    • Cmax_pos: 47
    • Smax: 0.267
    • Smax_pos: 2
    • Smean: 0.192
    • D: 0.162
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQIEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKELIKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQNRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIEDINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRANVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]