From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006000000
  • symbol?: opuCA
  • description?: glycine/betaine ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • glycine/betaine ABC transporter ATP-binding protein
    • amino acid ABC transporter ATP-binding protein
    • glycine betaine/carnitine/choline ABC transporter opuCA
    • glycine betaine/L-proline transport ATP-binding subunit
    • glycine betaine/carnitine/choline ABC transporter ATP-binding protein
    • OsmotiCALL import_20_25_26_pangenomey activated L-carnitine/choline ABC transporter, ATP-binding protein OpuCA
    • putative glycine betaine/carnitine/cholinetransport ATP-binding protein
    • betaine-carnitine-choline ABC transporter
    • glycine betaine/carnitine/choline ABC transporter
    • glycine betaine/carnitine/choline transport ATP-binding protein opuCA
    • glycine betaine/choline ABC superfamily ATP binding cassette transporter, ABC protein
    • glycine betaine/choline ABC transporter ATP-binding protein
    • glycine betaine/L-proline ABC transporter ATPase
    • glycine betaine/L-proline ABC transporter ATP-binding protein
    • glycine betaine/L-proline transporter ATP-binding subunit
    • glycine betaine transport ATP-binding protein
  • strand?: -
  • coordinates?: 6061557..6062789
  • synteny block?: BlockID0047440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2237 (opuCA)
    NCTC8325:
    Newman:
    NWMN_2347 (opuCA)
    USA300_FPR3757:
    SAUSA300_2393 (opuCa)
    04-02981:
    SA2981_2385 (opuCA)
    08BA02176:
    C248_2498 (opuCA)
    11819-97:
    MS7_2462 (proV)
    71193:
    ST398NM01_2500
    ECT-R 2:
    ECTR2_2306 (proV)
    ED133:
    SAOV_2498c
    ED98:
    SAAV_2514
    HO 5096 0412:
    SAEMRSA15_23480 (opuCA)
    JH1:
    SaurJH1_2523
    JH9:
    SaurJH9_2475
    JKD6008:
    SAA6008_02490 (opuCA)
    JKD6159:
    SAA6159_02346 (opuCA)
    LGA251:
    SARLGA251_22290 (opuCA)
    M013:
    M013TW_2411
    MRSA252:
    SAR2538 (opuCA)
    MSHR1132:
    SAMSHR1132_22760
    MSSA476:
    SAS2340
    Mu3:
    SAHV_2432 (opuCA)
    Mu50:
    SAV2448 (opuCA)
    MW2:
    MW2372 (opuCA)
    RF122:
    SAB2330c (opuCA)
    ST398:
    SAPIG2500
    T0131:
    SAT0131_02647 (ffh)
    TCH60:
    HMPREF0772_10740 (opuCA)
    TW20:
    SATW20_25770 (opuCA)
    USA300_TCH1516:
    USA300HOU_2437
    VC40:
    SAVC_11115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQ
    N315            MIMLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQ
    NCTC8325        --MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQ
    Newman          --MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQ
    USA300_FPR3757  --MLSIKHLTKIYSGNKKAVDDISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATEGQ
                      **********************************************************

    COL             IEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKEL
    N315            IEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKEL
    NCTC8325        IEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKEL
    Newman          IEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKEL
    USA300_FPR3757  IEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHMTIKENIVLVPKLLKWTKEEKDKRAKEL
                    ************************************************************

    COL             IKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLV
    N315            IKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLV
    NCTC8325        IKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLV
    Newman          IKLVDLPESFLERYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLV
    USA300_FPR3757  IKLVDLPESFLERYPAEISGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLV
                    *****************:******************************************

    COL             KTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQ
    N315            KTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQ
    NCTC8325        KTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQ
    Newman          KTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQ
    USA300_FPR3757  KTLQRKLGKTFIFVTHDMDEAIKLADKICIMSEGKVVQFDTPDNILRHPANDFVRDFIGQ
                    ************************************************************

    COL             NRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIE
    N315            NRLIQDRPNDKTVEGVMIKPITIQADATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIE
    NCTC8325        NRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIE
    Newman          NRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIE
    USA300_FPR3757  NRLIQDRPNDKTVEGVMIKPITIQAEATLNDAVHIMRQKRVDAIFVVDSNNHLLGFLDIE
                    *************************:****************:*****************

    COL             DINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRA
    N315            DINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDKQRLVGLITRA
    NCTC8325        DINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRA
    Newman          DINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRA
    USA300_FPR3757  DINQGIRGHKSLRDTMQQHIYTVQIDSKLQDSVRTILKRNVRNVPVVDDQQRLVGLITRA
                    *************************************************:**********

    COL             NVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
    N315            NVVDIVYDTIWGDSEDAVQTEHVGEDTVSSKMHEQHTTNVKVRDIGDDKS
    NCTC8325        NVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
    Newman          NVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
    USA300_FPR3757  NVVDIVYDTIWGDSEDTVQTEHVGEDTASSKVHEQHTTNVKVRDIGDDKS
                    ****************:**********.***:******************