From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan006006000
  • symbol?:
  • description?: amino acid transporter

      descriptions from strain specific annotations:

    • amino acid transporter
    • amino acid permease-associated region
    • amino acid permease family protein
    • APC family amino acid-polyamine-organocation transporter
    • putative amino acid permease
    • amino acid transporter permease
  • strand?: +
  • coordinates?: 6064350..6065987
  • synteny block?: BlockID0047500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2387
    08BA02176:
    C248_2501
    11819-97:
    MS7_2464
    71193:
    ST398NM01_2503
    ECT-R 2:
    ECTR2_2308
    ED133:
    SAOV_2501
    ED98:
    SAAV_2517
    HO 5096 0412:
    SAEMRSA15_23500
    JH1:
    SaurJH1_2526
    JH9:
    SaurJH9_2477
    JKD6008:
    SAA6008_02492
    JKD6159:
    SAA6159_02348
    LGA251:
    SARLGA251_22310
    M013:
    M013TW_2413
    MRSA252:
    SAR2540
    MSHR1132:
    SAMSHR1132_22780
    MSSA476:
    SAS2342
    Mu3:
    SAHV_2434
    Mu50:
    SAV2450
    MW2:
    MW2374
    RF122:
    SAB2332
    ST398:
    SAPIG2503
    T0131:
    SAT0131_02650
    TCH60:
    HMPREF0772_10738
    TW20:
    SATW20_25790
    USA300_TCH1516:
    USA300HOU_2440
    VC40:
    SAVC_11125

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKDKQLHNDKINLSQLVLLGLGSLIGSGWLFGAWEASSIAGPAAIISWVLGFLVIGTIA
    N315            MNKDKQLHNDKINLSQLVLLGLGSLIGSGWLFGAWEASSIAGPVAIISWVLGFLVIGTIA
    NCTC8325        MNKDKQLHNDKINLSQLVLLGLGSLIGSGWLFGAWEASSIAGPAAIISWVLGFLVIGTIA
    Newman          MNKDKQLHNDKINLSQLVLLGLGSLIGSGWLFGAWEASSIAGPAAIISWVLGFLVIGTIA
    USA300_FPR3757  MNKDKQLHNDKINLSQLVLLGLGSLIGSGWLFGAWEASSIAGPAAIISWVLGFLVIGTIA
                    *******************************************.****************

    COL             YNYIEIGTMFPQSGGMSNYAQYTHGSLLGFIAAWANWVSLVTIIPIEAVSAVQYMSSWPW
    N315            YNYIEIGTMFPQSGGMSNYAQYTHGSLLGFIAAWANWVSLVTIIPIEAVSAVQYMSSWPW
    NCTC8325        YNYIEIGTMFPQSGGMSNYAQYTHGSLLGFIAAWANWVSLVTIIPIEAVSAVQYMSSWPW
    Newman          YNYIEIGTMFPQSGGMSNYAQYTHGSLLGFIAAWANWVSLVTIIPIEAVSAVQYMSSWPW
    USA300_FPR3757  YNYIEIGTMFPQSGGMSNYAQYTHGSLLGFIAAWANWVSLVTIIPIEAVSAVQYMSSWPW
                    ************************************************************

    COL             HWAKPMRYLMENGSISTYGLLAVYLIIVIFSLLNYWSVKLLTSFTSLISVFKLGVPMLTI
    N315            HWAKPMRYLMENGSISTYGLLAVYLIIVIFSLLNYWSVKLLTSFTSLISVFKLGVPMLTI
    NCTC8325        HWAKPMRYLMENGSISTYGLLAVYLIIVIFSLLNYWSVKLLTSFTSLISVFKLGVPMLTI
    Newman          HWAKPMRYLMENGSISTYGLLAVYLIIVIFSLLNYWSVKLLTSFTSLISVFKLGVPMLTI
    USA300_FPR3757  HWAKPMRYLMENGSISTYGLLAVYLIIVIFSLLNYWSVKLLTSFTSLISVFKLGVPMLTI
                    ************************************************************

    COL             IMLMLSGFDTSNYGHSASTFMPYGSAPIFAATTASGIIFSFNSFQTIINMGSEIKNPEKN
    N315            IMLMLSGFDTSNYGHSASTFMPYGSAPIFAATTASGIIFSFNSFQTIINMGSEIKNPEKN
    NCTC8325        IMLMLSGFDTSNYGHSASTFMPYGSAPIFAATTASGIIFSFNSFQTIINMGSEIKNPEKN
    Newman          IMLMLSGFDTSNYGHSASTFMPYGSAPIFAATTASGIIFSFNSFQTIINMGSEIKNPEKN
    USA300_FPR3757  IMLMLSGFDTSNYGHSASTFMPYGSAPIFAATTASGIIFSFNSFQTIINMGSEIKNPEKN
                    ************************************************************

    COL             IARGIAISLSISAVLYIILQSTFITSMPQSMLQHSGWNGINFNSPFADLAILLGINWLAI
    N315            IARGIAISLSISAVLYIILQSTFITSMPQSMLQHSGWNGINFNSPFADLAILLGINWLAI
    NCTC8325        IARGIAISLSISAVLYIILQSTFITSMPQSMLQHSGWNGINFNSPFADLAILLGINWLAI
    Newman          IARGIAISLSISAVLYIILQSTFITSMPQSMLQHSGWNGINFNSPFADLAILLGINWLAI
    USA300_FPR3757  IARGIAISLSISAVLYIILQSTFITSMPQSMLQHSGWNGINFNSPFADLAILLGINWLAI
                    ************************************************************

    COL             LLYIEAFVSPFGTGVSFVAVTGRVLRAMEKNGHIPKFLGKMNEKYHIPRVAIIFNAIISM
    N315            LLYIEAFVSPFGTGVSFVAVTGRVLRAMEKNGHIPKFLGKMNEKYHIPRVAIIFNAIISM
    NCTC8325        LLYIEAFVSPFGTGVSFVAVTGRVLRAMEKNGHIPKFLGKMNEKYHIPRVAIIFNAIISM
    Newman          LLYIEAFVSPFGTGVSFVAVTGRVLRAMEKNGHIPKFLGKMNEKYHIPRVAIIFNAIISM
    USA300_FPR3757  LLYIEAFVSPFGTGVSFVAVTGRVLRAMEKNGHIPKFLGKMNEKYHIPRVAIIFNAIISM
                    ************************************************************

    COL             IMVTLFRDWGTLAAVISTATLVAYLTGPTTVIALRKMGPTMTRPFRAKILKVMAPLSFVL
    N315            IMVTLFRDWGTLAAVISTATLVAYLTGPTTVIALRKMGPTMTRPFRAKILKVMAPLSFVL
    NCTC8325        IMVTLFRDWGTLAAVISTATLVAYLTGPTTVIALRKMGPTMTRPFRAKILKVMAPLSFVL
    Newman          IMVTLFRDWGTLAAVISTATLVAYLTGPTTVIALRKMGPTMTRPFRAKILKVMAPLSFVL
    USA300_FPR3757  IMVTLFRDWGTLAAVISTATLVAYLTGPTTVIALRKMGPTMTRPFRAKILKVMAPLSFVL
                    ************************************************************

    COL             ASLAIYWAMWPTTAEVILIIILGLPIYFFYEYRMNWRNTKKQIGGSLWIIVYLIVLSILS
    N315            ASLAIYWAMWPTTAEVILIIILGLPIYFFYEYRMNWRNTKKQIGGSLWIIVYLIVLSILS
    NCTC8325        ASLAIYWAMWPTTAEVILIIILGLPIYFFYEYRMNWRNTKKQIGGSLWIIVYLIVLSILS
    Newman          ASLAIYWAMWPTTAEVILIIILGLPIYFFYEYRMNWRNTKKQIGGSLWIIVYLIVLSILS
    USA300_FPR3757  ASLAIYWAMWPTTAEVILIIILGLPIYFFYEYRMNWRNTKKQIGGSLWIIVYLIVLSILS
                    ************************************************************

    COL             FIGSKEFKGLNMIHYPFDFIVIIIVALIFYYIGTTSSFESVYFRRATRINTKMRESLNNE
    N315            FIGSKEFKGLNMIHYPFDFIVIIVVALIFYYIGTTSSFESVYFRRATRINTKMRESLNNE
    NCTC8325        FIGSKEFKGLNMIHYPFDFIVIIIVALIFYYIGTTSSFESVYFRRATRINTKMRESLNNE
    Newman          FIGSKEFKGLNMIHYPFDFIVIIIVALIFYYIGTTSSFESVYFRRATRINTKMRESLNNE
    USA300_FPR3757  FIGSKEFKGLNMIHYPFDFIVIIIVALIFYYIGTTSSFESVYFRRATRINTKMRESLNNE
                    ***********************:************************************

    COL             SKSSH
    N315            SKSSH
    NCTC8325        SKSSH
    Newman          SKSSH
    USA300_FPR3757  SKSSH
                    *****