From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006007000
  • symbol?: pnbA
  • description?: carboxylesterase/lipase family protein

      descriptions from strain specific annotations:

    • carboxylesterase/lipase family protein
    • para-nitrobenzyl esterase
    • para-nitrobenzyl esterase chain A
    • carboxylesterase type B
    • alpha/beta hydrolase fold family protein
    • carboxylesterase
    • carboxylesterase family protein
    • putative carboxylesterase
  • strand?: +
  • coordinates?: 6066674..6068026
  • synteny block?: BlockID0047510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2459 (pnbA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2388
    08BA02176:
    C248_2502
    11819-97:
    MS7_2465
    71193:
    ST398NM01_2504
    ECT-R 2:
    ECTR2_2309
    ED133:
    SAOV_2502
    ED98:
    SAAV_2518 (pnbA)
    HO 5096 0412:
    SAEMRSA15_23510
    JH1:
    SaurJH1_2527
    JH9:
    SaurJH9_2478
    JKD6008:
    SAA6008_02493 (pnbA)
    JKD6159:
    SAA6159_02349 (pnbA)
    LGA251:
    SARLGA251_22320
    M013:
    M013TW_2414
    MRSA252:
    SAR2541
    MSHR1132:
    SAMSHR1132_22790
    MSSA476:
    SAS2343
    Mu3:
    SAHV_2435
    Mu50:
    SAV2451
    MW2:
    MW2375
    RF122:
    SAB2333
    ST398:
    SAPIG2504
    T0131:
    SAT0131_02651 (aur)
    TCH60:
    HMPREF0772_10737 (pnbA)
    TW20:
    SATW20_25800
    USA300_TCH1516:
    USA300HOU_2441 (pnbA)
    VC40:
    SAVC_11130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKINTTGGQIHGITQDGLDIFLGIPYAEPPVHDNRFKHSTLKTQWSEPIDATEIQPIPPQ
    N315            MKINTTGGQIHGITQDGLDIFLGIPYAEPPVHDNRFKHSTLKTQWSEPIDATEIQPIPPQ
    NCTC8325        MKINTTGGQIHGITQDGLDIFLGIPYAEPPVHDNRFKHSTLKTQWSEPIDATEIQPIPPQ
    Newman          MKINTTGGQIHGITQDGLDIFLGIPYAEPPVHDNRFKHSTLKTQWSEPIDATEIQPIPPQ
    USA300_FPR3757  MKINTTGGQIHGITQDGLDIFLGIPYAEPPVHDNRFKHSTLKTQWSEPIDATEIQPIPPQ
                    ************************************************************

    COL             PDNKLEDFFSSQSTTFTEHEDCLYLNIWKQHNDQTKKPVIIYFYGGSFENGHGKAELYQP
    N315            PDNKLEDFFSSQSTTFTEHEDCLYLNIWKQHNDQTKKPVIIYFYGGSFENGHGTAELYQP
    NCTC8325        PDNKLEDFFSSQSTTFTEHEDCLYLNIWKQHNDQTKKPVIIYFYGGSFENGHGTAELYQP
    Newman          PDNKLEDFFSSQSTTFTEHEDCLYLNIWKQHNDQTKKPVIIYFYGGSFENGHGKAELYQP
    USA300_FPR3757  PDNKLEDFFSSQSTTFTEHEDCLYLNIWKQHNDQTKKPVIIYFYGGSFENGHGTAELYQP
                    *****************************************************.******

    COL             AHLVQNNDIIVITCNYRLGALGYLDWSYFNKDFHSNNGLSDQINVIKWVHQFIESFGGDA
    N315            AHLVQNNDIIVITCNYRLGALGYLDWSYFNKDFHSNNGLSDQINVIKWVHQFIESFGGDA
    NCTC8325        AHLVQNNDIIVITCNYRLGALGYLDWSYFNKDFHSNNGLSDQINVIKWVHQFIESFGGDA
    Newman          AHLVQNNDIIVITCNYRLGALGYLDWSYFNKDFHSNNGLSDQINVIKWVHQFIESFGGDA
    USA300_FPR3757  AHLVQNNDIIVITCNYRLGALGYLDWSYFNKDFHSNNGLSDQINVIKWVHQFIESFGGDA
                    ************************************************************

    COL             NNITLMGQSAGSMSILTLLKIPDIEPYFHKVVLLSGALRLDTLESARNKAQHFQKMMLDY
    N315            NNITLMGQSAGSMSILTLLKIPDIEPYFHKVVLLSGALRLDTLKSARNKAQYFQKMMRDY
    NCTC8325        NNITLMGQSAGSMSILTLLKIPDIEPYFHKVVLLSGALRLDTLESARNKAQHFQKMMLDY
    Newman          NNITLMGQSAGSMSILTLLKIPDIEPYFHKVVLLSGALRLDTLESARNKAQHFQKMMLDY
    USA300_FPR3757  NNITLMGQSAGSMSILTLLKIPDIEPYFHKVVLLSGALRLDTLESARNKAQHFQKMMLDY
                    *******************************************:*******:***** **

    COL             LDTDDVTSLSTNDILMLMAKLKQSRGPSKGLDLIYAPIKTDYIQNNYPTTKPIFACYTKD
    N315            LDTDDVTSLSTDDILMLMAKLKQSRGPSKGLDLIYAPIKTDYIQNDYPTTKPIFACYTKD
    NCTC8325        LDTDDVTSLSTNDILMLMAKLKQSRGPSKGLDLIYAPIKTDYIQNNYPTTKPIFACYTKD
    Newman          LDTDDVTSLSTNDILMLMAKLKQSRGPSKGLDLIYAPIKTDYIQNNYPTTKPIFACYTKD
    USA300_FPR3757  LDTDDVTSLSTNDILMLMAKLKQSRGPSKGLDLIYAPIKTDYIQNNYPTTKPIFACYTKD
                    ***********:*********************************:**************

    COL             EGDIYITSEQKKLSPQRFIDIMELNDIPLKYEDVQTAKQQSLAITHCYFKQPMKQFLQQL
    N315            EGDIYITSEQKKLSPQRFIDIMELNDIPLKYEDVQTAKQQSLAITHCYFKQPMKQFLQHL
    NCTC8325        EGDIYITSEQKKLSPQRFIDIMELNDIPLKYEDVQTAKQQSLAITHCYFKQPMKQFLQQL
    Newman          EGDIYITSEQKKLSPQRFIDIMELNDIPLKYEDVQTAKQQSLAITHCYFKQPMKQFLQQL
    USA300_FPR3757  EGDIYITSEQKKLSPQRFIDIMELNDIPLKYEDVQTAKQQSLAITHCYFKQPMKQFLQQL
                    **********************************************************:*

    COL             NIQDSNAQLWLAEFAWHDTSSAHYRSAYHILDMVFWFGNLQILAAHQYPTTAHLKFLSRQ
    N315            NIQDSNAQLWLAEFAWHDTSSAHYRSAYHILDMVFWFGNLQILAAHQYPTTAHLKFLSRQ
    NCTC8325        NIQDSNAQLWLAEFAWHDTSSAHYRSAYHILDMVFWFGNLQILAAHQYPTTAHLKFLSRQ
    Newman          NIQDSNAQLWLAEFAWHDTSSAHYRSAYHILDMVFWFGNLQILAAHQYPTTAHLKFLSRQ
    USA300_FPR3757  NIQDSNAQLWLAEFAWHDTSSAHYRSAYHILDMVFWFGNLQILAAHQYPTTAHLKFLSRQ
                    ************************************************************

    COL             MQNDLANFAKSGKMPWPMYHNERRYYRTYQ
    N315            MQNDLANFAKSGKMPWPMYHNERRYYRTYQ
    NCTC8325        MQNDLANFAKSGKMPWPMYHNERRYYRTYQ
    Newman          MQNDLANFAKSGKMPWPMYHNERRYYRTYQ
    USA300_FPR3757  MQNDLANFAKSGKMPWPMYHNERRYYRTYQ
                    ******************************