From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006009000
  • symbol?:
  • description?: ABC transporter ATP-binding protein

      descriptions from strain specific annotations:

    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • ABC superfamily ATP binding cassette transporter, permease protein
    • membrane transporter
    • ABC transporter permease
    • YbbM seven transmembrane helix protein
  • strand?: -
  • coordinates?: 6069680..6070505
  • synteny block?: BlockID0047530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2390
    08BA02176:
    C248_2504
    11819-97:
    MS7_2467
    71193:
    ST398NM01_2506
    ECT-R 2:
    ECTR2_2311
    ED133:
    SAOV_2504c
    ED98:
    SAAV_2520
    HO 5096 0412:
    SAEMRSA15_23530
    JH1:
    SaurJH1_2529
    JH9:
    SaurJH9_2480
    JKD6008:
    SAA6008_02495
    JKD6159:
    SAA6159_02351
    LGA251:
    SARLGA251_22340
    M013:
    M013TW_2416
    MRSA252:
    SAR2543
    MSHR1132:
    SAMSHR1132_22810
    MSSA476:
    SAS2345
    Mu3:
    SAHV_2437
    Mu50:
    SAV2453
    MW2:
    MW2377
    RF122:
    SAB2335c
    ST398:
    SAPIG2506
    T0131:
    SAT0131_02653 (trmD)
    TCH60:
    HMPREF0772_10735 (ybbM)
    TW20:
    SATW20_25820
    USA300_TCH1516:
    USA300HOU_2443
    VC40:
    SAVC_11140

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNTALGLTALLLVIPIIISYKEGLHIIKDLIVATLRAVVQLIILGFLLHYIFKINDKWL
    N315            MSNTALGLTALLLVIPIIISYKEGLHIIKDLIVATLRAVVQLIILGFLLHYIFKINDKWL
    NCTC8325        MSNTALGLTALLLVIPIIISYKEGLHIIKDLIVATLRAVVQLIILGFLLHYIFKINDKWL
    Newman          MSNTALGLTALLLVIPIIISYKEGLHIIKDLIVATLRAVVQLIILGFLLHYIFKINDKWL
    USA300_FPR3757  MSNTALGLTALLLVIPIIISYKEGLHIIKDLIVATLRAVVQLIILGFLLHYIFKINDKWL
                    ************************************************************

    COL             LILCVLVIIINASWNTISRASPVMHHVFWISFLAIFIGTALPLAGTIATGAIQFTANEVI
    N315            LILCVLVIIINASWNTISRASPVMHHVFWISFLAIFIGTALPLAGTVATGAIHFTANEVI
    NCTC8325        LILCVLVIIINASWNTISRASPVMHHVFWISFLAIFIGTALPLAGTIATGAIQFTANEVI
    Newman          LILCVLVIIINASWNTISRASPVMHHVFWISFLAIFIGTALPLAGTIATGAIQFTANEVI
    USA300_FPR3757  LILCVLVIIINASWNTISRASPVMHHVFWISFLAIFIGTALPLAGTIATGAIQFTANEVI
                    **********************************************:*****:*******

    COL             PIGGMLANNGLIAINLAYQNLDRAFVQDGTNIESKLSLAATPKLASKGAIRESIRLAIVP
    N315            PIGGMLANNGLIAINLAYQNLDRAFVQDGTNIESKLSLAATPKLASKGAIRESIRLAIVP
    NCTC8325        PIGGMLANNGLIAINLAYQNLDRAFVQDGTNIESKLSLAATPKLASKGAIRESIRLAIVP
    Newman          PIGGMLANNGLIAINLAYQNLDRAFVQDGTNIESKLSLAATPKLASKGAIRESIRLAIVP
    USA300_FPR3757  PIGGMLANNGLIAINLAYQNLDRAFVQDGTNIESKLSLAATPKLASKGAIRESIRLAIVP
                    ************************************************************

    COL             TIDSVKTYGLVSIPGMMTGLIIGGVPPLQAIKFQLLVVFIHTTATIMSALIATYLSYGQF
    N315            TIDSVKTYGLVSIPGMMTGLIIGGVPPLQAIKFQLLVVFIHTTATIMSALIATYLSYGQF
    NCTC8325        TIDSVKTYGLVSIPGMMTGLIIGGVPPLQAIKFQLLVVFIHTTATIMSALIATYLSYGQF
    Newman          TIDSVKTYGLVSIPGMMTGLIIGGVPPLQAIKFQLLVVFIHTTATIMSALIATYLSYGQF
    USA300_FPR3757  TIDSVKTYGLVSIPGMMTGLIIGGVPPLQAIKFQLLVVFIHTTATIMSALIATYLSYGQF
                    ************************************************************

    COL             FNARHQLVARNTDVKSES
    N315            FNARHQLVARNTDVKSES
    NCTC8325        FNARHQLVARNTDVKSES
    Newman          FNARHQLVARNTDVKSES
    USA300_FPR3757  FNARHQLVARNTDVKSES
                    ******************