From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006018000
  • symbol?:
  • description?: glutamate synthase

      descriptions from strain specific annotations:

    • glutamate synthase
    • ferredoxin-dependent glutamate synthase
    • glutamate synthase-related protein
    • glutamate synthase-ferredoxin large subunit
    • glutamate synthase subunit alpha
    • glutamate synthase (NADPH)
  • strand?: -
  • coordinates?: 6075555..6077132
  • synteny block?: BlockID0047620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2396
    08BA02176:
    C248_2510
    11819-97:
    MS7_2473
    71193:
    ST398NM01_2510
    ECT-R 2:
    ECTR2_2317
    ED133:
    SAOV_2510c
    ED98:
    SAAV_2526
    HO 5096 0412:
    SAEMRSA15_23580
    JH1:
    SaurJH1_2536
    JH9:
    SaurJH9_2487
    JKD6008:
    SAA6008_02501 (gltB2)
    JKD6159:
    SAA6159_02357 (gltB2)
    LGA251:
    SARLGA251_22400
    M013:
    M013TW_2420
    MRSA252:
    SAR2547
    MSHR1132:
    SAMSHR1132_22850
    MSSA476:
    SAS2351
    Mu3:
    SAHV_2443
    Mu50:
    SAV2459
    MW2:
    MW2383
    RF122:
    SAB2343c
    ST398:
    SAPIG2510
    T0131:
    SAT0131_02659 (sucC)
    TCH60:
    HMPREF0772_10729
    TW20:
    SATW20_25880
    USA300_TCH1516:
    USA300HOU_2450 (gltB2)
    VC40:
    SAVC_11170

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTFLTVMQFIVNIIVVGFMLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
    N315            MTFLTVMQFIVNIIVVGFLLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
    NCTC8325        MTFLTVMQFIVNIIVVGFMLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
    Newman          MTFLTVMQFIVNIIVVGFMLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
    USA300_FPR3757  MTFLTVMQFIVNIIVVGFMLTVIVIGLIWLIKDKRQSQHSVLRNYPLLARIRYISEKMGP
                    ******************:*****************************************

    COL             ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
    N315            ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
    NCTC8325        ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
    Newman          ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
    USA300_FPR3757  ELRQYLFSGDNEGKPFSRNDYKNIVLAGKYNSRMTSFGTTKDYQDGFYIQNTMFPMQRNE
                    ************************************************************

    COL             ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
    N315            ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
    NCTC8325        ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
    Newman          ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
    USA300_FPR3757  ISVDNTTLLSTFIYKIANERLFSREEYRVPTKIDPYYLSDDHAIKLGEHLKHPFILKRIV
                    ************************************************************

    COL             GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
    N315            GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
    NCTC8325        GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
    Newman          GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
    USA300_FPR3757  GQSGMSYGALGKNAITALSKGLAKAGTWMNTGEGGLSEYHLKGNGDIIFQIGPGLFGVRD
                    ************************************************************

    COL             KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
    N315            KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
    NCTC8325        KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
    Newman          KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
    USA300_FPR3757  KEGNFSEGLFKEVAQLSNVRAFELKLAQGAKTRGGHMEAEKVNEEIAKIRNVEPYKTINS
                    ************************************************************

    COL             PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
    N315            PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
    NCTC8325        PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
    Newman          PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
    USA300_FPR3757  PNRYEFIHNAEDLIRFVDQLQQLGQKPVGFKIVVSKVSEIETLVRTMVELDKYPSFITID
                    ************************************************************

    COL             GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
    N315            GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
    NCTC8325        GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
    Newman          GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
    USA300_FPR3757  GGEGGTGATFQELQDGVGLPLFTALPIVSGMLEKYGIRDKVKLAASGKLVTPDKIAIALG
                    ************************************************************

    COL             LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
    N315            LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
    NCTC8325        LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
    Newman          LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
    USA300_FPR3757  LGADFVNIARGMMISVGCIMSQQCHMNTCPVGVATTDAKKEKALIVGEKQYRVTNYVTSL
                    ************************************************************

    COL             HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS
    N315            HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS
    NCTC8325        HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS
    Newman          HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS
    USA300_FPR3757  HEGLFNIAAAVGVSSPTEITADHIVYRKVDGELQTIHDYKLKLIS
                    *********************************************