From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006022000
  • symbol?:
  • description?: MFS transporter

      descriptions from strain specific annotations:

    • MFS transporter
    • transporter
    • putative transporter
    • antibiotic resistance protein
    • antibiotic resistance transport protein
    • Bicyclomycin resistance protein
    • Major facilitator superfamily MFS_1
    • major facilitator superfamily protein
    • major facilitator transporter
    • MFS family major facilitator transporter
    • putative transport protein
    • transporter, putative
  • strand?: -
  • coordinates?: 6078629..6079822
  • synteny block?: BlockID0047660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2399
    08BA02176:
    C248_2512
    11819-97:
    MS7_2475
    71193:
    ST398NM01_2512
    ECT-R 2:
    ECTR2_2319
    ED133:
    SAOV_2512c
    ED98:
    SAAV_2528
    HO 5096 0412:
    SAEMRSA15_23600
    JH1:
    SaurJH1_2538
    JH9:
    SaurJH9_2489
    JKD6008:
    SAA6008_02503
    JKD6159:
    SAA6159_02359
    LGA251:
    SARLGA251_22420
    M013:
    M013TW_2422
    MRSA252:
    SAR2549
    MSHR1132:
    SAMSHR1132_22870
    MSSA476:
    SAS2353
    Mu3:
    SAHV_2446
    Mu50:
    SAV2462
    MW2:
    MW2386
    RF122:
    SAB2345c
    ST398:
    SAPIG2512
    T0131:
    SAT0131_02661
    TCH60:
    HMPREF0772_10727
    TW20:
    SATW20_25900
    USA300_TCH1516:
    USA300HOU_2453
    VC40:
    SAVC_11180

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKGAMAWPFLRLYILTLMFFSANAILNVFIPLRGHDLGATNTVIGIVMGAYMLTAMVFRP
    N315            MKGAMAWPFLRLYILTLMFFSANAILNVFIPLRGHDLGATNTVIGIVMGAYMLTAMVFRP
    NCTC8325        MKGAMAWPFLRLYILTLMFFSANAILNVFIPLRGHDLGATNTVIGIVMGAYMLTAMVFRP
    Newman          MKGAMAWPFLRLYILTLMFFSANAILNVFIPLRGHDLGATNTVIGIVMGAYMLTAMVFRP
    USA300_FPR3757  MKGAMAWPFLRLYILTLMFFSANAILNVFIPLRGHDLGATNTVIGIVMGAYMLTAMVFRP
                    ************************************************************

    COL             WAGQIIARVGPIKVLRFILIINAIALIIYGFTGLEGYFVARVMQGVCTAFFSMSLQLGII
    N315            WAGQIIARVGPIKVLRIILIINAIALIIYGFTGLEGYFVARVMQGVCTAFFSMSLQLGII
    NCTC8325        WAGQIIARVGPIKVLRIILIINAIALIIYGFTGLEGYFVARVMQGVCTAFFSMSLQLGII
    Newman          WAGQIIARVGPIKVLRIILIINAIALIIYGFTGLEGYFVARVMQGVCTAFFSMSLQLGII
    USA300_FPR3757  WAGQIIARVGPIKVLRIILIINAIALIIYGFTGLEGYFVARVMQGVCTAFFSMSLQLGII
                    ****************:*******************************************

    COL             DALPEEHRSEGVSLYSLFSTIPNLIGPLVAVGIWNANNISLFAIVIIFIALTTTFFGYRV
    N315            DALPEEHRSEGVSLYSLFSTIPNLIGPLVAVGIWNANNISLFAIVIIFIALTTTFFGYRV
    NCTC8325        DALPEEHRSEGVSLYSLFSTIPNLIGPLVAVGIWNANNISLFAIVIIFIALTTTFFGYRV
    Newman          DALPEEHRSEGVSLYSLFSTIPNLIGPLVAVGIWNANNISLFAIVIIFIALTTTFFGYRV
    USA300_FPR3757  DALPEEHRSEGVSLYSLFSTIPNLIGPLVAVGIWNANNISLFAIVIIFIALTTTFFGYRV
                    ************************************************************

    COL             TFAEQEPDTSDKIEKMPFNAVTVFAQFFKNKELLNSGIIMIVASIVFGAVSTFVPLYTVS
    N315            TFAEQEPDTSDKIEKMPFNAVTVFAQFFKNKELLNSGIIMIVASIVFGAVSTFVPLYTVS
    NCTC8325        TFAEQEPDTSDKIEKMPFNAVTVFAQFFKNKELLNSGIIMIVASIVFGAVSTFVPLYTVS
    Newman          TFAEQEPDTSDKIEKMPFNAVTVFAQFFKNKELLNSGIIMIVASIVFGAVSTFVPLYTVS
    USA300_FPR3757  TFAEQEPDTSDKIEKMPFNAVTVFAQFFKNKELLNSGIIMIVASIVFGAVSTFVPLYTVS
                    ************************************************************

    COL             LGFANAGIFLTIQAIAVVAARFYLRKYIPSDGMWHPKYMVSVLSLLVIASFVVAFGPQVG
    N315            LGFANAGIFLTIQAIAVVAARFYLRKYIPSDGMWHPKYMVSVLSLLVIASFVVAFGPQVG
    NCTC8325        LGFANAGIFLTIQAIAVVAARFYLRKYIPSDGMWHPKYMVSVLSLLVIASFVVAFGPQVG
    Newman          LGFANAGIFLTIQAIAVVAARFYLRKYIPSDGMWHPKYMVSVLSLLVIASFVVAFGPQVG
    USA300_FPR3757  LGFANAGIFLTIQAIAVVAARFYLRKYIPSDGMWHPKYMVSVLSLLVIASFVVAFGPQVG
                    ************************************************************

    COL             AIIFYGSAILIGMTQAMVYPTLTSYLSFVLPKVGRNMLLGLFIACADLGISLGGALMGPI
    N315            AIIFYGSAILIGMTQAMVYPTLTSYLSFVLPKVGRNMLLGLFIACADLGISLGGALMGPI
    NCTC8325        AIIFYGSAILIGMTQAMVYPTLTSYLSFVLPKVGRNMLLGLFIACADLGISLGGALMGPI
    Newman          AIIFYGSAILIGMTQAMVYPTLTSYLSFVLPKVGRNMLLGLFIACADLGISLGGALMGPI
    USA300_FPR3757  AIIFYGSAILIGMTQAMVYPTLTSYLSFVLPKVGRNMLLGLFIACADLGISLGGALMGPI
                    ************************************************************

    COL             SDLVGFKWMYLICGMLVIVIMIMSFLKKPTPRPASSL
    N315            SDLVGFKWMYLICGMLVIVIMIMSFLKKPTPRPASSL
    NCTC8325        SDLVGFKWMYLICGMLVIVIMIMSFLKKPTPRPASSL
    Newman          SDLVGFKWMYLICGMLVIVIMIMSFLKKPTPRPASSL
    USA300_FPR3757  SDLVGFKWMYLICGMLVIVIMIMSFLKKPTPRPASSL
                    *************************************