From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006025000
  • symbol?: cnzC
  • description?: oligopeptide transporter permease

      descriptions from strain specific annotations:

    • oligopeptide transporter permease
    • binding-protein-dependent transport systems inner membrane component
    • peptide ABC transporter permease
    • Oligopeptide transporter putative membrane permease domain protein
    • binding-protein-dependent transport system inner membrane component family protein
    • oligopeptide transporter membrane permease
    • oligopeptide ABC transporter permease
    • nickel ABC transporter permease
    • oligopeptide transporter putative membrane permease
    • oligopeptide ABC transporter membrane protein
    • oligopeptide ABC transporter permease Opp-1C
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • binding--dependent transport system inner membrane component family protein
    • opp-1C protein
    • nickel transport system permease protein
  • strand?: -
  • coordinates?: 6081388..6082257
  • synteny block?: BlockID0047690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2253 (opp-1C)
    NCTC8325:
    Newman:
    NWMN_2362 (opp1C)
    USA300_FPR3757:
    04-02981:
    SA2981_2402 (opp-1C)
    08BA02176:
    C248_2515 (opp-1C)
    11819-97:
    MS7_2478
    71193:
    ST398NM01_2515
    ECT-R 2:
    ECTR2_2322
    ED133:
    SAOV_2515c
    ED98:
    SAAV_2531
    HO 5096 0412:
    SAEMRSA15_23630 (opp-1C)
    JH1:
    SaurJH1_2541
    JH9:
    SaurJH9_2492
    JKD6008:
    SAA6008_02506 (opp-1C)
    JKD6159:
    SAA6159_02362 (opp-1C)
    LGA251:
    SARLGA251_22450 (opp-1C)
    M013:
    M013TW_2425
    MRSA252:
    SAR2552 (opp-1C)
    MSHR1132:
    SAMSHR1132_22900
    MSSA476:
    SAS2356
    Mu3:
    SAHV_2449
    Mu50:
    SAV2465
    MW2:
    MW2389 (opp-1C)
    RF122:
    SAB2348c (opp1C)
    ST398:
    SAPIG2515
    T0131:
    SAT0131_02664 (fmhC)
    TCH60:
    HMPREF0772_10724 (opp-1C)
    TW20:
    SATW20_25930 (opp-1C)
    USA300_TCH1516:
    USA300HOU_2456
    VC40:
    SAVC_11195

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIILKRLLQDKGAVIALGIIVLYVFLGLAAPLVTFYDPNHIDTANKFAGMSFQHLLGTDH
    N315            MIILKRLLQDKGAVIALGIIVLYVFLGLAAPLVTFYDPNHIDTANKFAGISFQHLLGTDH
    NCTC8325        MIILKRLLQDKGAVIALGIIVLYVFLGLAAPLVTFYDPNHIDTANKFAGMSFQHLLGTDH
    Newman          MIILKRLLQDKGAVIALGIIVLYVFLGLAAPLVTFYDPNHIDTANKFAGMSFQHLLGTDH
    USA300_FPR3757  MIILKRLLQDKGAVIALGIIVLYVFLGLAAPLVTFYDPNHIDTANKFAGMSFQHLLGTDH
                    *************************************************:**********

    COL             LGRDILTRLIYAIRPSLLYVFVALFVSVLIGSILGFLSGYFQGFVDALIMRACDVMLAFP
    N315            LGRDILTRLIYAIRPSLLYVFVALFVSVLIGSILGFLSGYFQGFVDALIMRACDVMLAFP
    NCTC8325        LGRDILTRLIYAIRPSLLYVFVALFVSVLIGSILGFLSGYFQGFVDALIMRACDVMLAFP
    Newman          LGRDILTRLIYAIRPSLLYVFVALFVSVLIGSILGFLSGYFQGFVDALIMRACDVMLAFP
    USA300_FPR3757  LGRDILTRLIYAIRPSLLYVFVALFVSVLIGSILGFLSGYFQGFVDALIMRACDVMLAFP
                    ************************************************************

    COL             SYVVTLALIALFGMGAENIIMAFILTRWAWFCRVIRTSVMQYTASDHVRFAKTIGMNDMK
    N315            SYVVTLALIALFGMGAENIIMAFILTRWAWFCRVIRTSVMQYTASDHVRFAKTIGMNDMK
    NCTC8325        SYVVTLALIALFGMGAENIIMAFILTRWAWFCRVIRTSVMQYTASDHVRFAKTIGMNDMK
    Newman          SYVVTLALIALFGMGAENIIMAFILTRWAWFCRVIRTSVMQYTASDHVRFAKTIGMNDMK
    USA300_FPR3757  SYVVTLALIALFGMGAENIIMAFILTRWAWFCRVIRTSVMQYTASDHVRFAKTIGMNDMK
                    ************************************************************

    COL             IIHKHIMPLTLADIAIISSSSMCSMILQISGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
    N315            IIHKHIMPLTLADIAIISSSSMCSMILQISGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
    NCTC8325        IIHKHIMPLTLADIAIISSSSMCSMILQISGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
    Newman          IIHKHIMPLTLADIAIISSSSMCSMILQISGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
    USA300_FPR3757  IIHKHIMPLTLADIAIISSSSMCSMILQISGFSFLGLGVKAPTAEWGMMLNEARKVMFTH
                    ************************************************************

    COL             PEMMFAPGIAIVIIVMAFNFLSDALQIAIDPRISSKDKLRSVKKGVVQS
    N315            PEMMFAPGIAIVIIVMAFNFLSDALQIAIDPRISSKDKLRSVKKGVVQS
    NCTC8325        PEMMFAPGIAIVIIVMAFNFLSDALQIAIDPRISSKDKLRSVKKGVVQS
    Newman          PEMMFAPGIAIVIIVMAFNFLSDALQIAIDPRISSKDKLRSVKKGVVQS
    USA300_FPR3757  PEMMFAPGIAIVIIVMAFNFLSDALQIAIDPRISSKDKLRSVKKGVVQS
                    *************************************************