From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006027000
  • symbol?: cntA
  • description?: nickel ABC transporter, nickel/metallophore periplasmic binding protein

      descriptions from strain specific annotations:

    • nickel ABC transporter, nickel/metallophore periplasmic binding protein
    • oligopeptide permease, peptide-binding protein
    • peptide ABC transporter peptide-binding protein
    • oligopeptide transporter substrate binding protein
    • peptide ABC transporter substrate-binding protein
    • oligopeptide transporter putative substratebinding domain
    • Oligopeptide transporter putative substrate binding domain protein
    • dipeptide-binding ABC transporter, periplasmicsubstrate-binding component
    • nickel ABC transporter, periplasmic nickel-binding protein
    • nickel ABC transporter periplasmic nickel-binding protein
    • oligopeptide ABC superfamily ATP binding cassette transporter, binding protein
    • oligopeptide ABC transporter substrate-binding protein
    • oligopeptide transporter substrate binding domain-containing protein
    • peptide ABC transporter peptide-binding protein Opp-1A
  • strand?: -
  • coordinates?: 6083202..6084791
  • synteny block?: BlockID0047710
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2255 (opp-1A)
    NCTC8325:
    Newman:
    NWMN_2364 (opp1A)
    USA300_FPR3757:
    SAUSA300_2411 (opp-1A)
    04-02981:
    SA2981_2404 (opp-1A)
    08BA02176:
    C248_2517 (opp-1A)
    11819-97:
    MS7_2480 (nikA)
    71193:
    ST398NM01_2517
    ECT-R 2:
    ECTR2_2324 (nikA)
    ED133:
    SAOV_2517c
    ED98:
    SAAV_2533
    HO 5096 0412:
    SAEMRSA15_23650 (opp-1A)
    JH1:
    SaurJH1_2543
    JH9:
    SaurJH9_2494
    JKD6008:
    SAA6008_02508 (opp-1A)
    JKD6159:
    SAA6159_02364 (opp-1A)
    LGA251:
    SARLGA251_22470 (opp-1A)
    M013:
    M013TW_2427
    MRSA252:
    SAR2554 (opp-1A)
    MSHR1132:
    SAMSHR1132_22920
    MSSA476:
    SAS2358
    Mu3:
    SAHV_2451
    Mu50:
    SAV2467
    MW2:
    MW2391 (opp-1A)
    RF122:
    SAB2350c (opp1A)
    ST398:
    SAPIG2517 (nikA)
    T0131:
    SAT0131_02666 (topA)
    TCH60:
    HMPREF0772_10722 (opp-1A)
    TW20:
    SATW20_25950 (opp-1A)
    USA300_TCH1516:
    USA300HOU_2458
    VC40:
    SAVC_11205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKLTKMSAMLLTSGLILTGCGGNKGLEEKKENKQLTYTTVKDIGDMNPHVYGGSMSAES
    N315            MRKLTKMSAMLLASGLILTGCGGNKGLEEKKENKQLTYTTVKDIGDMNPHVYGGSMSAES
    NCTC8325        MRKLTKMSAMLLASGLILTGCGGNKGLEEKKENKQLTYTTVKDIGDMNPHVYGGSMSAES
    Newman          MRKLTKMSAMLLASGLILTGCGGNKGLEEKKENKQLTYTTVKDIGDMNPHVYGGSMSAES
    USA300_FPR3757  MRKLTKMSAMLLASGLILTGCGGNKGLEEKKENKQLTYTTVKDIGDMNPHVYGGSMSAES
                    ************:***********************************************

    COL             MIYEPLVRNTKDGIKPLLAKKWDVSEDGKTYTFHLRDDVKFHDGTPFDADAVKKNIDAVQ
    N315            MIYEPLVRNTKDGIKPLLAKKWDVSEDGKTYTFHLRDDVKFHDGTTFDADAVKKNIDAVQ
    NCTC8325        MIYEPLVRNTKDGIKPLLAKKWDVSEDGKTYTFHLRDDVKFHDGTPFDADAVKKNIDAVQ
    Newman          MIYEPLVRNTKDGIKPLLAKKWDVSEDGKTYTFHLRDDVKFHDGTPFDADAVKKNIDAVQ
    USA300_FPR3757  MIYEPLVRNTKDGIKPLLAKKWDVSEDGKTYTFHLRDDVKFHDGTPFDADAVKKNIDAVQ
                    *********************************************.**************

    COL             ENKKLHSWLKISTLIDNVKVKDKYTVELNLKEAYQPALAELAMPRPYVFVSPKDFKNGTT
    N315            QNKKLHSWLKISTLIDNVKVKDKYTVELNLKEAYQPALAELAMPRPYVFVSPKDFKNGTT
    NCTC8325        ENKKLHSWLKISTLIDNVKVKDKYTVELNLKEAYQPALAELAMPRPYVFVSPKDFKNGTT
    Newman          ENKKLHSWLKISTLIDNVKVKDKYTVELNLKEAYQPALAELAMPRPYVFVSPKDFKNGTT
    USA300_FPR3757  ENKKLHSWLKISTLIDNVKVKDKYTVELNLKEAYQPALAELAMPRPYVFVSPKDFKNGTT
                    :***********************************************************

    COL             KDGVKKFDGTGPFKLGEHKKDESADFNKNDQYWGEKSKLNKVQAKVMPAGETAFLSMKKG
    N315            KDGVKKFDGTGPFKLGEHKKDESADFNKNDQYWGEKSKLNKVQAKVMPAGETAFLSMKKG
    NCTC8325        KDGVKKFDGTGPFKLGEHKKDESADFNKNDQYWGEKSKLNKVQAKVMPAGETAFLSMKKG
    Newman          KDGVKKFDGTGPFKLGEHKKDESADFNKNDQYWGEKSKLNKVQAKVMPAGETAFLSMKKG
    USA300_FPR3757  KDGVKKFDGTGPFKLGEHKKDESADFNKNDQYWGEKSKLNKVQAKVMPAGETAFLSMKKG
                    ************************************************************

    COL             ETNFAFTDDRGTDSLDKDSLKQLKDTGDYQVKRSQPMNTKMLVVNSGKKDNAVSDKTVRQ
    N315            ETNFAFTDDRGTDSLDKDSLKQLKDTGDYQVKRSQPMNTKMLVVNSGKKDNAVSDKTVRQ
    NCTC8325        ETNFAFTDDRGTDSLDKDSLKQLKDTGDYQVKRSQPMNTKMLVVNSGKKDNAVSDKTVRQ
    Newman          ETNFAFTDDRGTDSLDKDSLKQLKDTGDYQVKRSQPMNTKMLVVNSGKKDNAVSDKTVRQ
    USA300_FPR3757  ETNFAFTDDRGTDSLDKDSLKQLKDTGDYQVKRSQPMNTKMLVVNSGKKDNAVSDKTVRQ
                    ************************************************************

    COL             AIGHMVNRDKIAKEILDGQEKPATQLFAKNVTDINFDMPTRKYDLKKAESLLDEAGWKKG
    N315            AIGHMVNRDKIAKEILDGQEKPATQLFAKNVTDINFDMPTRKYDLKKAESLLDEAGWKKG
    NCTC8325        AIGHMVNRDKIAKEILDGQEKPATQLFAKNVTDINFDMPTRKYDLKKAESLLDEAGWKKG
    Newman          AIGHMVNRDKIAKEILDGQEKPATQLFAKNVTDINFDMPTRKYDLKKAESLLDEAGWKKG
    USA300_FPR3757  AIGHMVNRDKIAKEILDGQEKPATQLFAKNVTDINFDMPTRKYDLKKAESLLDEAGWKKG
                    ************************************************************

    COL             KDSDVRQKDGKNLEMAMYYDKGSSSQKEQAEYLQAEFKKMGIKLNINGETSDKIAERRTS
    N315            KDSDVRQKDGKNLEMAMYYDKGSSSQKEQAEYLQAEFKKMGIKLNINGETSDKIAERRTS
    NCTC8325        KDSDVRQKDGKNLEMAMYYDKGSSSQKEQAEYLQAEFKKMGIKLNINGETSDKIAERRTS
    Newman          KDSDVRQKDGKNLEMAMYYDKGSSSQKEQAEYLQAEFKKMGIKLNINGETSDKIAERRTS
    USA300_FPR3757  KDSDVRQKDGKNLEMAMYYDKGSSSQKEQAEYLQAEFKKMGIKLNINGETSDKIAERRTS
                    ************************************************************

    COL             GDYDLMFNQTWGLLYDPQSTIAAFKAKNGYESATSGIENKDKIYNSIDDAFKIQNGKERS
    N315            GDYDLMFNQTWGLLYDPQSTIAAFKAKNGYESATSGIENKDKIYNSIDDAFKIQNGKERS
    NCTC8325        GDYDLMFNQTWGLLYDPQSTIAAFKEKNGYESATSGIENKDKIYNSIDDAFKIQNGKERS
    Newman          GDYDLMFNQTWGLLYDPQSTIAAFKAKNGYESATSGIENKDKIYNSIDDAFKIQNGKERS
    USA300_FPR3757  GDYDLMFNQTWGLLYDPQSTIAAFKAKNGYESATSGIENKDKIYNSIDDAFKIQNGKERS
                    ************************* **********************************

    COL             DAYKNILKQIDDEGIFIPISHGSMTVVAPKDLEKVSFTQSQYELPFNEMQYK
    N315            DAYKNILKQIDDEGIFIPISHGSMTVVAPKDLEKVSFTQSQYELPFNEMQYK
    NCTC8325        DAYKNILKQIDDEGIFIPISHGSMTVVAPKDLEKVSFTQSQYELPFNEMQYK
    Newman          DAYKNILKQIDDEGIFIPISHGSMTVVAPKDLEKVSFTQSQYELPFNEMQYK
    USA300_FPR3757  DAYKNILKQIDDEGIFIPISHGSMTVVAPKDLEKVSFTQSQYELPFNEMQYK
                    ****************************************************