From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006056000
  • symbol?:
  • description?: oxidoreductase

      descriptions from strain specific annotations:

    • oxidoreductase
    • short-chain dehydrogenase/reductase SDR
    • short chain dehydrogenase/reductase family oxidoreductase
    • Short-chain alcohol dehydrogenase
    • clavaldehyde dehydrogenase
    • putative short chain dehydrogenase
    • short chain dehydrogenase/reductase oxidoreductase
    • NAD-dependent epimerase/dehydratase
    • pseudogene
    • Oxidoreductase, short-chaindehydrogenase/reductase family
    • oxidoreductase, short-chain dehydrogenase
    • oxidoreductase family protein
  • strand?: -
  • coordinates?: 6109222..6109917
  • synteny block?: BlockID0047980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2415
    08BA02176:
    C248_2535
    11819-97:
    MS7_2489
    71193:
    ST398NM01_2535
    ECT-R 2:
    ECTR2_2335
    ED133:
    SAOV_2526c
    ED98:
    SAAV_2544
    HO 5096 0412:
    SAEMRSA15_23760
    JH1:
    SaurJH1_2555
    JH9:
    SaurJH9_2505
    JKD6008:
    SAA6008_02519
    JKD6159:
    SAA6159_02374
    LGA251:
    SARLGA251_22640
    M013:
    M013TW_2439
    MRSA252:
    SAR2567
    MSHR1132:
    SAMSHR1132_23010
    MSSA476:
    SAS2370
    Mu3:
    SAHV_2462
    Mu50:
    SAV2478
    MW2:
    MW2403
    RF122:
    SAB2359c
    ST398:
    SAPIG2535
    T0131:
    SAT0131_02677 (uppS)
    TCH60:
    HMPREF0772_10709 (bdhA)
    TW20:
    SATW20_26050
    USA300_TCH1516:
    USA300HOU_2470
    VC40:
    SAVC_11265

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVLTDKVAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDSVKVVPT
    N315            MTVLTDKIAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKDKLQNVANQLAQDSVKVVPT
    NCTC8325        MTVLTDKVAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDSVKVVPT
    Newman          MTVLTDKVAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDSVKVVPT
    USA300_FPR3757  MTVLTDKVAVVTGAGSGIGEAIATLLHEEGAKVVLAGRNKEKLQNVANQLSQDSVKVVPT
                    *******:********************************:*********:*********

    COL             DVTNKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTA
    N315            DVTNKEEVDELMKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTA
    NCTC8325        DVTNKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTA
    Newman          DVTNKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTA
    USA300_FPR3757  DVTNKEEVDELIKIAQQTFGGLDIVINSAGQMLSSKITDYQVDEWDSMIDVNIKGTLYTA
                    ***********:************************************************

    COL             QAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTS
    N315            QAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTS
    NCTC8325        QAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTS
    Newman          QAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTS
    USA300_FPR3757  QAALPTMLEQSSGHLINIASISGFEVTKSSTIYSATKAAVHTITQGLEKELAKTGVKVTS
                    ************************************************************

    COL             ISPGMVDTAITAAYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEITVRPV
    N315            ISPGMVDTAITAAYNPSDRKKLDPQDIAEAVLYALTQPKHVNVNEITVRPV
    NCTC8325        ISPGMVDTAITAAYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEITVRPV
    Newman          ISPGMVDTAITAAYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEITVRPV
    USA300_FPR3757  ISPGMVDTAITAAYNPTDRKKLEPQDIAEAVLYALTQPKHVNVNEITVRPV
                    ****************:*****:****************************