From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006068000
  • symbol?:
  • description?: tandem-type lipoprotein

      descriptions from strain specific annotations:

    • tandem-type lipoprotein
    • putative tandem lipoprotein
    • lipoprotein
    • putative staphylococcal tandem lipoprotein
    • staphylococcus tandem lipoproteins family protein
  • strand?: -
  • coordinates?: 6114787..6118029
  • synteny block?: BlockID0048090
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2418
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_2338
    ED133:
    ED98:
    SAAV_2547
    HO 5096 0412:
    SAEMRSA15_23810
    JH1:
    SaurJH1_2559
    JH9:
    SaurJH9_2508
    JKD6008:
    SAA6008_02522
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2570
    MSHR1132:
    SAMSHR1132_23080
    MSSA476:
    Mu3:
    SAHV_2465
    Mu50:
    SAV2481
    MW2:
    RF122:
    ST398:
    T0131:
    SAT0131_02682
    TCH60:
    HMPREF0772_10705
    TW20:
    SATW20_26080
    USA300_TCH1516:
    USA300HOU_2473
    VC40:
    SAVC_11280

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIHSKKLTLGICLVLLIILIVGYVIMTKTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEG
    N315            MIHSKKLTLGICLVLLIILIVGYVIMTKTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEG
    NCTC8325        MIHSKKLTLGICLVLLIILIVGYVIMTKTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEG
    Newman          MIHSKKLTLGICLVLLIILIVGYVIMTKTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEG
    USA300_FPR3757  MIHSKKLTLGICLVLLIILIVGYVIMTKTNGRNAQIKDTFNQTLKLYPTKNLDDFYDKEG
                    ************************************************************

    COL             FRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNG
    N315            FRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNG
    NCTC8325        FRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNG
    Newman          FRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNG
    USA300_FPR3757  FRDQEFKKGDKGTWIVNSEMVIEPKGKDMETRGMVLYINRNTRTTKGYYFISEMTDDSNG
                    ************************************************************

    COL             RPKDDEKRYPVKMEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNP
    N315            RPKDDEKRYPVKMEHNKIIPTKPLPNDKLRKEIENFKFFVQYGDFKDINDYKDGDISYNP
    NCTC8325        RPKDDEKRYPVKMEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNP
    Newman          RPKDDEKRYPVKMEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNP
    USA300_FPR3757  RPKDDEKRYPVKMEHNKIIPTKPLPNDKLKKEIENFKFFVQYGNFKDINDYKDGDISYNP
                    *****************************:*************:****************

    COL             NVPSYSAKYQLNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGSSVGSRSLEFTFVEN
    N315            NVPSYSAKYQLKNDDYNVKQLRKRYNIPTNKAPKLLIKGDGDLKGSSVGSKNLEFTFVEN
    NCTC8325        NVPSYSAKYQLNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGSSVGSRSLEFTFVEN
    Newman          NVPSYSAKYQLNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGSSVGSRSLEFTFVEN
    USA300_FPR3757  NVPSYSAKYQLNNDDYNVQQLRKRYDIPTKQAPKLLLKGDGDLKGSSVGSRSLEFTFVEN
                    ***********:******:******:***::*****:*************:.********

    COL             KEENIYFTDSVQYTPSEDTRYESN
    N315            KEENIYFTDSVQYTSSEDTSYESN
    NCTC8325        KEENIYFTDSVQYTPSEDTRYESN
    Newman          KEENIYFTDSVQYTPSEDTRYESN
    USA300_FPR3757  KEENIYFTDSVQYTPSEDTRYESN
                    **************.**** ****