From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006083000
  • symbol?:
  • description?: helicase

      descriptions from strain specific annotations:

    • helicase
    • putative helicase
    • DEAD/DEAH box helicase
    • DEAD/H helicase / Type III restriction enzyme, res subunit
    • DNA/RNA helicase of DEAD/DEAH box family
    • DNA or RNA helicase
    • helicase, putative
    • type III restriction enzyme, res subunit
    • type III restriction protein res subunit
  • strand?: -
  • coordinates?: 6135884..6138001
  • synteny block?: BlockID0048220
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2425
    08BA02176:
    11819-97:
    MS7_2495
    71193:
    ECT-R 2:
    ECTR2_2345
    ED133:
    SAOV_2534c
    ED98:
    SAAV_2555
    HO 5096 0412:
    SAEMRSA15_23880
    JH1:
    SaurJH1_2567
    JH9:
    SaurJH9_2515
    JKD6008:
    SAA6008_02524
    JKD6159:
    SAA6159_02383
    LGA251:
    SARLGA251_22700
    M013:
    M013TW_2454
    MRSA252:
    SAR2574
    MSHR1132:
    SAMSHR1132_23100
    MSSA476:
    SAS2376
    Mu3:
    SAHV_2472
    Mu50:
    SAV2488
    MW2:
    MW2409
    RF122:
    ST398:
    T0131:
    SAT0131_02684 (polC)
    TCH60:
    HMPREF0772_10702
    TW20:
    SATW20_26100
    USA300_TCH1516:
    USA300HOU_2480
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSRLLNDFNQSLHKGFIDKHISHKGNYTPKLLVNNKNEKVLSTIIDELQKCETFYFSVAF
    N315            ------------------------------------------------------------
    NCTC8325        MSRLLNDFNQSLHKGFIDKHISHKGNYTPKLLVNNKNEKVLSTIIDELQKCETFYFSVAF
    Newman          MSRLLNDFNQSLHKGFIDKHISHKGNYTPKLLVNNKNEKVLSTIIDELQKCETFYFSVAF
    USA300_FPR3757  MSRLLNDFNQSLHKGFIDKHISHKGNYTPKLLVNNKNEKVLSTIIDELQKCETFYFSVAF
                                                                                

    COL             ITESGLASLKAQLLDLSNKGVKGKILTSNYLGFNSPKMYGELLKLKNVEVRLTDIAGFHA
    N315            ------------------------------------------------------------
    NCTC8325        ITESGLASLKAQLLDLSNKGVKGKILTSNYLGFNSPKMYGELLKLKNVEVRLTDIAGFHA
    Newman          ITESGLASLKAQLLDLSNKGVKGKILTSNYLGFNSPKMYGELLKLKNVEVRLTDIAGFHA
    USA300_FPR3757  ITESGLASLKAQLLDLSNKGVKGKILTSNYLGFNSPKMYGELLKLKNVEVRLTDIAGFHA
                                                                                

    COL             KGYIFEHKDYSSMVIGSSNLTSNALKVNYEHNVLLSTMKNGDLVDSVKSEFDLLWQKSTP
    N315            ------------------------------------------------------------
    NCTC8325        KGYIFEHKDYSSMVIGSSNLTSNALKVNYEHNVLLSTMKNGDLVDSVKSEFDLLWQKSTP
    Newman          KGYIFEHKDYSSMVIGSSNLTSNALKVNYEHNVLLSTMKNGDLVDSVKSEFDLLWQKSTP
    USA300_FPR3757  KGYIFEHKDYSSMVIGSSNLTSNALKVNYEHNVLLSTMKNGDLVDSVKSEFDLLWQKSTP
                                                                                

    COL             LTEQWINSYKESFEYRSLEKLAEVEQTQMLLADKVKKSVEIVPNLMQAEALRSLKAIRDK
    N315            ------------------------------------------------------------
    NCTC8325        LTEQWINSYKESFEYRSLEKLAEVEQTQMLLADKVKKSVEIVPNLMQAEALRSLKAIRDK
    Newman          LTEQWINSYKESFEYRSLEKLAEVEQTQMLLADKVKKSVEIVPNLMQAEALRSLKAIRDK
    USA300_FPR3757  LTEQWINSYKESFEYRSLEKLAEVEQTQMLLADKVKKSVEIVPNLMQAEALRSLKAIRDK
                                                                                

    COL             AKDKALIISATGTGKTILCALDVREVNPNKFLFIVHNEGILNRAKEEFKKVLPIKNDSDF
    N315            ------------------------------------------------------------
    NCTC8325        AKDKALIISATGTGKTILCALDVREVNPNKFLFIVHNEGILNRAKEEFKKVLPIKNDSDF
    Newman          AKDKALIISATGTGKTILCALDVREVNPNKFLFIVHNEGILNRAKEEFKKVLPIKNDSDF
    USA300_FPR3757  AKDKALIISATGTGKTILCALDVREVNPNKFLFIVHNEGILNRAKEEFKKVLPIKNDSDF
                                                                                

    COL             GLLTGKHRDVDAKYLFATIQTLSRDDNFKQFDENEFDYIVFDEAHRSAASTYQRVFNYFK
    N315            ------------------------------------------------------------
    NCTC8325        GLLTGKHRDVDAKYLFATIQTLSRDDNFKQFDENEFDYIVFDEAHRSAASTYQRVFNYFK
    Newman          GLLTGKHRDVDAKYLFATIQTLSRDDNFKQFDENEFDYIVFDEAHRSAASTYQRVFNYFK
    USA300_FPR3757  GLLTGKHRDVDAKYLFATIQTLSRDDNFKQFDENEFDYIVFDEAHRSAASTYQRVFNYFK
                                                                                

    COL             PKFMLGMTATPERSDELSIFELFDYNIAYEIRLQAALESDILCPFHYFGVTDYVHQGIKE
    N315            ------------------------------------------------------------
    NCTC8325        PKFMLGMTATPERSDELSIFELFDYNIAYEIRLQAALESDILCPFHYFGVTDYVHQGIKE
    Newman          PKFMLGMTATPERSDELSIFELFDYNIAYEIRLQAALESDILCPFHYFGVTDYVHQGIKE
    USA300_FPR3757  PKFMLGMTATPERSDELSIFELFDYNIAYEIRLQAALESDILCPFHYFGVTDYVHQGIKE
                                                                                

    COL             DDVTKLRYLTSDERVNYIIQKTDYYGYSGEILQGLIFVSSKKEAYDLADKLSSKGIKSVA
    N315            -------------------------------------MSSKKEAYDLADKLSSKGIKSVA
    NCTC8325        DDVTKLRYLTSDERVNYIIQKTDYYGYSGEILQGLIFVSSKKEAYDLADKLSSKGIKSVA
    Newman          DDVTKLRYLTSDERVNYIIQKTDYYGYSGEILQGLIFVSSKKEAYDLADKLSSKGIKSVA
    USA300_FPR3757  DDVTKLRYLTSDERVNYIIQKTDYYGYSGEILQGLIFVSSKKEAYDLADKLSSKGIKSVA
                                                         :**********************

    COL             LTGDDSVNYRQIVIEKLKEGKINYIITVDLFNEGIDIPEVNQVVMLRPTESSIIFIQQLG
    N315            LTGDDSVNYRQIVIEKLKEGKINYIITVDLFNEGIDIPEVNQVVMLRPTESSIIFIQQLG
    NCTC8325        LTGDDSVNYRQIVIEKLKEGKINYIITVDLFNEGIDIPEVNQVVMLRPTESSIIFIQQLG
    Newman          LTGDDSVNYRQIVIEKLKEGKINYIITVDLFNEGIDIPEVNQVVMLRPTESSIIFIQQLG
    USA300_FPR3757  LTGDDSVNYRQIVIEKLKEGKINYIITVDLFNEGIDIPEVNQVVMLRPTESSIIFIQQLG
                    ************************************************************

    COL             RGLRKSSNKEYVTVIDFIGNYKTNYLIPIALSGDQSQNKDNYKKFLTNNDSINGVSTINF
    N315            RGLRKSANKEYVTVIDFIGNYKTNYLIPIALSGDQSQNKDNYKKFLTNNDSINGVSTINF
    NCTC8325        RGLRKSSNKEYVTVIDFIGNYKTNYLIPIALSGDQSQNKDNYKKFLTNNDSINGVSTINF
    Newman          RGLRKSSNKEYVTVIDFIGNYKTNYLIPIALSGDQSQNKDNYKKFLTNNDSINGVSTINF
    USA300_FPR3757  RGLRKSSNKEYVTVIDFIGNYKTNYLIPIALSGDQSQNKDNYKKFLTNNDSINGVSTINF
                    ******:*****************************************************

    COL             EEVAKKQIYNSLDAVSLNQNKLILKAYEEVENRLGHMPLLMDFIQQHSIDPSVIFSKFSN
    N315            EEVAKKQIYNSLDAVSLNQNKLILKAYEEVENRLGHMPLLMDFIQQHSIDPSVIFSKFSN
    NCTC8325        EEVAKKQIYNSLDAVSLNQNKLILKAYEEVENRLGHMPLLMDFIQQHSIDPSVIFSKFSN
    Newman          EEVAKKQIYNSLDAVSLNQNKLILKAYEEVENRLGHMPLLMDFIQQHSIDPSVIFSKFSN
    USA300_FPR3757  EEVAKKQIYNSLDAVSLNQNKLILKAYEEVENRLGHMPLLMDFIQQHSIDPSVIFSKFSN
                    ************************************************************

    COL             YYEFLVRYKKIDTLLTENESKNLVFFSRQIAPGLKRIDSLVLEELLKNELTYDELKNKML
    N315            YYEFLLRYKKIDALLTENESKNLVFFSRQIAPGLKRIDSLVLEELLKNELTYDELKNKML
    NCTC8325        YYEFLVRYKKIDTLLTENESKNLVFFSRQIAPGLKRIDSLVLEELLKNELTYDELKNKML
    Newman          YYEFLVRYKKIDTLLTENESKNLVFFSRQIAPGLKRIDSLVLEELLKNELTYDELKNKML
    USA300_FPR3757  YYEFLVRYKKIDTLLTENESKNLVFFSRQIAPGLKRIDSLVLEELLKNELTYDELKNKML
                    *****:******:***********************************************

    COL             NEVKDITEDDIDTSLRILDFSFYNAGIEKIYGSPIIERNERMIRLSDAFTNALSNQTFNM
    N315            NEVKDITEDDIDTSLRILDFSFYNAGIEKIYGSPIIECNERMIRLSDAFTNALSNQTFKI
    NCTC8325        NEVKDITEDDIDTSLRILDFSFYNAGIEKIYGSPIIERNERMIRLSDAFTNALSNQTFNM
    Newman          NEVKDITEDDIDTSLRILDFSFYNAGIEKIYGSPIIERNERMIRLSDAFTNALSNQTFNM
    USA300_FPR3757  NEVKDITEDDIDTSLRILDFSFYNAGIEKIYGSPIIERNERMIRLSDAFTNALSNQTFNM
                    ************************************* ********************::

    COL             FLEDLIELSKYNNEKYQKGKNGLILYNKYSREDFSKIFNWNKNGSSVIMGYMIKSQEMPI
    N315            FLEDLIELSKYNNEKYQKGKNGLILYNKYSREDFSKIFNWNKNGSSVIMGYMIRSQEMPI
    NCTC8325        FLEDLIELSKYNNEKYQKGKNGLILYNKYSREDFSKIFNWNKNGSSVIMGYMIKSQEMPI
    Newman          FLEDLIELSKYNNEKYQKGKNGLILYNKYSREDFSKIFNWNKNGSSVIMGYMIKSQEMPI
    USA300_FPR3757  FLEDLIELSKYNNEKYQKGKNGLILYNKYSREDFSKIFNWNKNGSSVIMGYMIKSQEMPI
                    *****************************************************:******

    COL             FITYDKHEDISDSTKYEDEFLSQDELKWFTKSNRTLESKEVQKILSHRAKGIKMYIFVQK
    N315            FITYDKHEDISDSTKYEDEFLSQDELKWFTKSNRTLKSKEVQKILSHRAKGIKMYIFVQK
    NCTC8325        FITYDKHEDISDSTKYEDEFLSQDELKWFTKSNRTLESKEVQKILSHRAKGIKMYIFVQK
    Newman          FITYDKHEDISDSTKYEDEFLSQDELKWFTKSNRTLESKEVQKILSHRAKGIKMYIFVQK
    USA300_FPR3757  FITYDKHEDISDSTKYEDEFLSQDELKWFTKSNRTLESKEVQKILSHRAKGIKMYIFVQK
                    ************************************:***********************

    COL             KDDDGIYFYYLGTAGYIEGSEKQDKMPNGSNVVTMDLALDKAVRDDIYRYLTN
    N315            KDDDGIYFYYLGTAGYIEGSEKQDKMPNGSNVVTMDLALDKAVRDDIYRYITN
    NCTC8325        KDDDGIYFYYLGTAGYIEGSEKQDKMPNGSNVVTMDLALDKAVRDDIYRYLTN
    Newman          KDDDGIYFYYLGTAGYIEGSEKQDKMPNGSNVVTMDLALDKAVRDDIYRYLTN
    USA300_FPR3757  KDDDGIYFYYLGTAGYIEGSEKQDKMPNGSNVVTMDLALDKAVRDDIYRYLTN
                    **************************************************:**