From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006092000
  • symbol?:
  • description?: exported protein
  • strand?: +
  • coordinates?: 6146425..6146691
  • synteny block?: BlockID0048290
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2428
    08BA02176:
    C248_2549
    11819-97:
    71193:
    ST398NM01_3008
    ECT-R 2:
    ED133:
    SAOV_2538
    ED98:
    SAAV_2559
    HO 5096 0412:
    SAEMRSA15_23910
    JH1:
    SaurJH1_2570
    JH9:
    SaurJH9_2518
    JKD6008:
    SAA6008_02528
    JKD6159:
    SAA6159_02386
    LGA251:
    SARLGA251_22730
    M013:
    MRSA252:
    SAR2577
    MSHR1132:
    SAMSHR1132_23130
    MSSA476:
    SAS2379
    Mu3:
    SAHV_2476
    Mu50:
    SAV2492
    MW2:
    MW2412
    RF122:
    SAB2372
    ST398:
    T0131:
    SAT0131_02688
    TCH60:
    HMPREF0772_10699
    TW20:
    SATW20_26130
    USA300_TCH1516:
    USA300HOU_2483
    VC40:
    SAVC_11335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSN
    N315            MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSN
    NCTC8325        MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSN
    Newman          MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSN
                    ************************************************************

    COL             LASLDLYAPVRNITSSRDIHPIYFMTKD
    N315            LASLDLYAPVRNITSSRDIHPIYFMTKD
    NCTC8325        LASLDLYAPVRNITSSRDIHPIYFMTKD
    Newman          LASLDLYAPVRNITSSRDIHPIYFMTKD
                    ****************************