From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006096000
  • symbol?: gtaB
  • description?: UTP-glucose-1-phosphate uridylyltransferase

      descriptions from strain specific annotations:

    • UTP-glucose-1-phosphate uridylyltransferase
    • UTP-glucose-1-phosphate uridyltransferase
    • UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  • strand?: -
  • coordinates?: 6147273..6148159
  • synteny block?: BlockID0048330
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2508 (galU)
    N315:
    SA2288 (gtaB)
    NCTC8325:
    Newman:
    NWMN_2395 (gtaB)
    USA300_FPR3757:
    04-02981:
    SA2981_2436 (gtaB)
    08BA02176:
    C248_2551 (gtaB)
    11819-97:
    MS7_2503 (galU)
    71193:
    ST398NM01_2549
    ECT-R 2:
    ECTR2_2353 (galU)
    ED133:
    SAOV_2541c
    ED98:
    SAAV_2565 (galU)
    HO 5096 0412:
    SAEMRSA15_23980 (gtaB)
    JH1:
    SaurJH1_2576
    JH9:
    SaurJH9_2524
    JKD6008:
    SAA6008_02535 (gtaB)
    JKD6159:
    SAA6159_02394 (galU)
    LGA251:
    SARLGA251_22750 (gtaB)
    M013:
    M013TW_2466
    MRSA252:
    SAR2579 (gtaB)
    MSHR1132:
    MSSA476:
    SAS2386
    Mu3:
    SAHV_2484 (gtaB)
    Mu50:
    SAV2500 (gtaB)
    MW2:
    MW2419 (gtaB)
    RF122:
    SAB2374c (gtaB)
    ST398:
    SAPIG2549 (galU)
    T0131:
    SAT0131_02698 (rbfA)
    TCH60:
    HMPREF0772_10697 (galU)
    TW20:
    SATW20_26200 (gtaB)
    USA300_TCH1516:
    USA300HOU_2489 (galU)
    VC40:
    SAVC_11370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
    N315            MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
    NCTC8325        ----------------------------MLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
    Newman          MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
    USA300_FPR3757  ----------------------------MLPILDKPTIQYIVEEAARAGIEDIIIVTGRH
                                                ********************************

    COL             KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
    N315            KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
    NCTC8325        KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
    Newman          KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
    USA300_FPR3757  KRAIEDHFDSQKELEMVLKEKGKSELLEKVQYSTELANIFYVRQKEQKGLGHAISSARQF
                    ************************************************************

    COL             IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
    N315            IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
    NCTC8325        IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
    Newman          IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
    USA300_FPR3757  IGNEPFAVLLGDDIVESEVPAVKQLIDVYEETGHSVIGVQEVPEADTHRYGIIDPLTKNG
                    ************************************************************

    COL             RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
    N315            RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
    NCTC8325        RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
    Newman          RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
    USA300_FPR3757  RQYEVKKFVEKPAQGTAPSNLAIMGRYVLTPEIFDYLKTQKEGAGNEIQLTDAIERMNND
                    ************************************************************

    COL             NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
    N315            NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
    NCTC8325        NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
    Newman          NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
    USA300_FPR3757  NQVYAYDFEGERYDVGEKLGFVKTTIEYALKDDSMREELTRFIKALGL
                    ************************************************