From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006109000
  • symbol?: sarT
  • description?: accessory regulator T

      descriptions from strain specific annotations:

    • accessory regulator T
    • transcriptional regulator
    • HTH-type transcriptional regulator sarT
    • accessory regulator A-like protein
    • putative staphylococcal accessory regulator
    • SarA family transcriptional regulator
    • staphylococcal accessory regulator T, SarT
    • transcriptional regulator SarT
    • Transcriptional regulator SarT (Staphylococcal accessory regulator T)
  • strand?: -
  • coordinates?: 6164213..6164569
  • synteny block?: BlockID0048440
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2506 (sarT)
    N315:
    SA2286 (sarT)
    NCTC8325:
    Newman:
    NWMN_2393 (sarT)
    USA300_FPR3757:
    04-02981:
    SA2981_2434 (sarT)
    08BA02176:
    11819-97:
    MS7_2501 (sarT)
    71193:
    ECT-R 2:
    ECTR2_2351
    ED133:
    ED98:
    SAAV_2563 (sarT)
    HO 5096 0412:
    SAEMRSA15_23960
    JH1:
    SaurJH1_2574
    JH9:
    SaurJH9_2522
    JKD6008:
    SAA6008_02533 (sarT)
    JKD6159:
    SAA6159_02392 (sarT)
    LGA251:
    M013:
    M013TW_2464
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2384
    Mu3:
    SAHV_2482 (sarH3)
    Mu50:
    SAV2498 (sarH3)
    MW2:
    MW2417 (sarT)
    RF122:
    ST398:
    T0131:
    SAT0131_02696 (infB)
    TCH60:
    TW20:
    SATW20_26180 (sarT)
    USA300_TCH1516:
    USA300HOU_2487 (sarT)
    VC40:
    SAVC_11360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MNDLKSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDII
    N315            MMNDLKSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDII
    NCTC8325        -------------MKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDII
    Newman          -MNDLKSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDII
    USA300_FPR3757  -MNDLKSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDII
                                 ***********************************************

    COL             SYIGIDQSRIVKSVKDLSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
    N315            SYIGIDQSRIVKSVKELSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
    NCTC8325        SYIGIDQSRIVKSVKDLSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
    Newman          SYIGIDQSRIVKSVKDLSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
    USA300_FPR3757  SYIGIDQSRIVKSVKDLSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
                    ***************:*******************************************