From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006110000
  • symbol?: sarU
  • description?: transcriptional regulator SarU

      descriptions from strain specific annotations:

    • transcriptional regulator SarU
    • putative staphylococcal accessory regulator
    • accessory regulator A-like protein
    • SarA family transcriptional regulator
    • accessory regulator U
    • HTH-type transcriptional regulator SarU
    • Transcriptional regulator SarU (Staphylococcal accessory regulator U)
    • staphylococcal accessory regulator A, SarH1
    • marR family protein
    • Accessory regulator A family protein
  • strand?: +
  • coordinates?: 6164893..6165636
  • synteny block?: BlockID0048440
  • occurrence?: in 72% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2507 (sarU)
    N315:
    SA2287 (sarH2)
    NCTC8325:
    Newman:
    NWMN_2394 (sarU)
    USA300_FPR3757:
    04-02981:
    SA2981_2435 (sarU)
    08BA02176:
    11819-97:
    MS7_2502 (sarU)
    71193:
    ECT-R 2:
    ECTR2_2352
    ED133:
    ED98:
    SAAV_2564 (sarU)
    HO 5096 0412:
    SAEMRSA15_23970
    JH1:
    SaurJH1_2575
    JH9:
    SaurJH9_2523
    JKD6008:
    SAA6008_02534 (sarH1)
    JKD6159:
    SAA6159_02393 (sarH1)
    LGA251:
    M013:
    M013TW_2465
    MRSA252:
    MSHR1132:
    MSSA476:
    SAS2385
    Mu3:
    SAHV_2483 (sarH2)
    Mu50:
    SAV2499 (sarH2)
    MW2:
    MW2418 (sarH2)
    RF122:
    ST398:
    T0131:
    SAT0131_02697
    TCH60:
    TW20:
    SATW20_26190 (sarU)
    USA300_TCH1516:
    USA300HOU_2488 (sarU)
    VC40:
    SAVC_11365

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDYQTFEKVNKFINVKAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
    N315            MDYQTFEKVNKFINVEAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
    NCTC8325        MDYQTFEKVNKFINVEAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
    Newman          MDYQTFEKVNKFINVKAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
    USA300_FPR3757  MDYQTFEKVNKFINVEAYIFFLTQELKQQYKLSLKELLILAYFYYKNEHSISLKEIIGDI
                    ***************:********************************************

    COL             LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
    N315            LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
    NCTC8325        LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
    Newman          LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
    USA300_FPR3757  LYKQSDVVKNIKSLSKKGFINKSRNEADERRIFVSVTPIQRKKIACVINELDKIIKGFNK
                    ************************************************************

    COL             ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
    N315            ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
    NCTC8325        ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
    Newman          ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
    USA300_FPR3757  ERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLDLSILYVISSRKNEILNLKD
                    ************************************************************

    COL             LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
    N315            LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
    NCTC8325        LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
    Newman          LFESIRFMYPQIVRSVNRLNNKGMLIKERSLADERIVLIKINKIQYNTIKSIFTDTSKIL
    USA300_FPR3757  LFESIRFMYPQIVRSVNRLNNKGMLIKERSHADERIVLIKINKIQYNTIKSIFTDTSKIL
                    ****************************** *****************************

    COL             KPRKFFF
    N315            KPRKFFF
    NCTC8325        KPRKFFF
    Newman          KPRKFFF
    USA300_FPR3757  KPRKFFF
                    *******