From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006134000
  • symbol?: relP
  • description?: RelA/SpoT domain-containing protein

      descriptions from strain specific annotations:

    • RelA/SpoT domain-containing protein
    • region found in RelA / SpoT proteins family protein
    • GTP pyrophosphokinase
    • relA-like (p)ppGpp synthetase
    • GTP pyrophosphokinase ywaC
  • strand?: -
  • coordinates?: 6209704..6210401
  • synteny block?: BlockID0048660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2445
    08BA02176:
    C248_2561
    11819-97:
    MS7_2512 (ywaC)
    71193:
    ST398NM01_2559
    ECT-R 2:
    ECTR2_2361
    ED133:
    SAOV_2550c
    ED98:
    SAAV_2574
    HO 5096 0412:
    SAEMRSA15_24050
    JH1:
    SaurJH1_2584
    JH9:
    SaurJH9_2532
    JKD6008:
    SAA6008_02544
    JKD6159:
    SAA6159_02403
    LGA251:
    SARLGA251_22820
    M013:
    M013TW_2474
    MRSA252:
    SAR2586
    MSHR1132:
    SAMSHR1132_23270
    MSSA476:
    SAS2394
    Mu3:
    SAHV_2493
    Mu50:
    SAV2509
    MW2:
    MW2427
    RF122:
    SAB2381c
    ST398:
    SAPIG2559
    T0131:
    SAT0131_02708
    TCH60:
    HMPREF0772_10688
    TW20:
    SATW20_26280
    USA300_TCH1516:
    USA300HOU_2496
    VC40:
    SAVC_11410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MYVDRKPSLYLEDLRHDFKNSLSKFENGDEAFDTLLGFVELDHIYSSALKEISTKLSILD
    N315            MYVDRKPSLYLEDLRHDFKNSLSKFENGDEAFDTLLGFVELDHIYSSALKEISTKLSILD
    NCTC8325        MYVDRKPSLYLEDLRHDFKNSLSKFENGDEAFDTLLGFVELDHIYSSALKEISTKLSILD
    Newman          MYVDRKPSLYLEDLRHDFKNSLSKFENGDEAFDTLLGFVELDHIYSSALKEISTKLSILD
    USA300_FPR3757  MYVDRKPSLYLEDLRHDFKNSLSKFENGDEAFDTLLGFVELDHIYSSALKEISTKLSILD
                    ************************************************************

    COL             DNFNHIYKHNPIHHMERRVKEMRSLIEKLNRKGLQISAETAKEHILDIAGIRVVCNYLDD
    N315            DNFNHIYKHNPIHHMERRVKEMRSLIEKLNRKGLQISAETAKEHILDIAGIRVVCNYLDD
    NCTC8325        DNFNHIYKHNPIHHMERRVKEMRSLIEKLNRKGLQISAETAKEHILDIAGIRVVCNYLDD
    Newman          DNFNHIYKHNPIHHMERRVKEMRSLIEKLNRKGLQISAETAKEHILDIAGIRVVCNYLDD
    USA300_FPR3757  DNFNHIYKHNPIHHMERRVKEMRSLIEKLNRKGLQISAETAKEHILDIAGIRVVCNYLDD
                    ************************************************************

    COL             IYLIEEMLLKQEDVQLIKRKDYIQHPKENGYRSLHIVVSIPVFLAERVEVLPVEIQIRTI
    N315            IYLIEEMLLKQEDVQLIKRKDYIQHPKENGYRSLHIVVSIPVFLAERVEVLPVEIQIRTI
    NCTC8325        IYLIEEMLLKQEDVQLIKRKDYIQHPKENGYRSLHIVVSIPVFLAERVEVLPVEIQIRTI
    Newman          IYLIEEMLLKQEDVQLIKRKDYIQHPKENGYRSLHIVVSIPVFLAERVEVLPVEIQIRTI
    USA300_FPR3757  IYLIEEMLLKQEDVQLIKRKDYIQHPKENGYRSLHIVVSIPVFLAERVEVLPVEIQIRTI
                    ************************************************************

    COL             GMDMWASLEHKIRYKNNAETEKYRDLLKECATEITEVEDKLQQIHSEITE
    N315            GMDMWASLEHKIRYKNNAETEKYRDLLKECATEITEVEDKLQQIHSEITE
    NCTC8325        GMDMWASLEHKIRYKNNAETEKYRDLLKECATEITEVEDKLQQIHSEITE
    Newman          GMDMWASLEHKIRYKNNAETEKYRDLLKECATEITEVEDKLQQIHSEITE
    USA300_FPR3757  GMDMWASLEHKIRYKNNAETEKYRDLLKECATEITEVEDKLQQIHSEITE
                    **************************************************