From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006136000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 6210755..6211171
  • synteny block?: BlockID0048680
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2446
    08BA02176:
    C248_2562
    11819-97:
    MS7_2513
    71193:
    ST398NM01_2560
    ECT-R 2:
    ECTR2_2362
    ED133:
    ED98:
    SAAV_2575
    HO 5096 0412:
    SAEMRSA15_24060
    JH1:
    SaurJH1_2585
    JH9:
    SaurJH9_2533
    JKD6008:
    SAA6008_02545
    JKD6159:
    SAA6159_02404
    LGA251:
    SARLGA251_22830
    M013:
    M013TW_2475
    MRSA252:
    SAR2587
    MSHR1132:
    SAMSHR1132_23280
    MSSA476:
    SAS2395
    Mu3:
    SAHV_2494
    Mu50:
    SAV2510
    MW2:
    MW2428
    RF122:
    SAB2382c
    ST398:
    SAPIG2560
    T0131:
    SAT0131_02709
    TCH60:
    HMPREF0772_10687
    TW20:
    SATW20_26290
    USA300_TCH1516:
    USA300HOU_2497
    VC40:
    SAVC_11415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFNMFHFIIMVVYNMNYNILEVKEMPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYL
    N315            MFNMFHFIIMVVYNMNYNILEVKEMPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYL
    NCTC8325        ------------------------MPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYL
    Newman          MFNMFHFIIMVVYNMNYNILEVKEMPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYL
    USA300_FPR3757  MFNMFHFIIMVVYNMNYNILEVKEMPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYL
                                            ************************************

    COL             EKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKTEVDSEYATTDNEEHIQE
    N315            EKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKAEVDSEYATTDNEEHIQE
    NCTC8325        EKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKTEVDSEYATTDNEEHIQE
    Newman          EKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKTEVDSEYATTDNEEHIQE
    USA300_FPR3757  EKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKTEVDSEYATTDNEEHIQE
                    ******************************************:*****************

    COL             QSNQDKSYFDSESIGNQSGGVRQREPLMDGPHPKVVESFKDV
    N315            QSNQDKSYFDSESIGNQSGGVRQREPLMDGAHPKVVESFKDV
    NCTC8325        QSNQDKSYFDSESIGNQSGGVRQREPLMDGPHPKVVESFKDV
    Newman          QSNQDKSYFDSESIGNQSGGVRQREPLMDGPHPKVVESFKDV
    USA300_FPR3757  QSNQDKSYFDSESIGNQSGGVRQREPLMDGPHPKVVESFKDV
                    ******************************.***********