From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006141000
  • symbol?:
  • description?: glucarate transporter

      descriptions from strain specific annotations:

    • glucarate transporter
    • major facilitator superfamily protein
    • major facilitator transporter
    • transporter, putative
    • transporter protein
    • putative transporter
    • major facilitator superfamily glucarate:cation symporter
    • putative transporter protein
    • MFS family major facilitator transporter, glucarate:cation symporter
    • transport protein
    • major facilitator superfamily MFS_1
    • major facilitator superfamily transporter protein
  • strand?: -
  • coordinates?: 6214123..6215364
  • synteny block?: BlockID0048720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2448
    08BA02176:
    C248_2565
    11819-97:
    MS7_2515
    71193:
    ST398NM01_2562
    ECT-R 2:
    ECTR2_2364
    ED133:
    SAOV_2554c
    ED98:
    SAAV_2577
    HO 5096 0412:
    SAEMRSA15_24080
    JH1:
    SaurJH1_2587
    JH9:
    SaurJH9_2535
    JKD6008:
    SAA6008_02547
    JKD6159:
    SAA6159_02406
    LGA251:
    SARLGA251_22850
    M013:
    M013TW_2477
    MRSA252:
    SAR2589
    MSHR1132:
    SAMSHR1132_23310
    MSSA476:
    SAS2397
    Mu3:
    SAHV_2496
    Mu50:
    SAV2512
    MW2:
    MW2431
    RF122:
    SAB2385c
    ST398:
    SAPIG2562
    T0131:
    SAT0131_02712
    TCH60:
    HMPREF0772_10685
    TW20:
    SATW20_26310
    USA300_TCH1516:
    USA300HOU_2499
    VC40:
    SAVC_11425

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKEKRTNVRWMFALAFFFIGVIAYMDRANISYIAKQMMDDLGMTKPQFGLLASFFSLGYA
    N315            MKEKRTNVRWMFALAFFFIGVIAYMDRANISYIAKQMMDDLGMTKPQFGLLASFFSLGYA
    NCTC8325        MKEKRTNVRWMFALAFFFIGVIAYMDRANISYIAKQMMDDLGMTKPQFGLLASFFSLGYA
    Newman          MKEKRTNVRWMFALAFFFIGVIAYMDRANISYIAKQMMDDLGMTKPQFGLLASFFSLGYA
    USA300_FPR3757  MKEKRTNVRWMFALAFFFIGVIAYMDRANISYIAKQMMDDLGMTKPQFGLLASFFSLGYA
                    ************************************************************

    COL             LMQVPSGMLAEKFGPRKMITIALVWWSAFTILTGMIKNHGLIYLVRFLFGVGEAPMYPSN
    N315            LMQVPSGMLAEKFGPRKMITIALVWWSAFTILTGMIKNHGLIYLVRFLFGVGEAPMYPSN
    NCTC8325        LMQVPSGMLAEKFGPRKMITIALVWWSAFTILTGMIKNHGLIYLVRFLFGVGEAPMYPSN
    Newman          LMQVPSGMLAEKFGPRKMITIALVWWSAFTILTGMIKNHGLIYLVRFLFGVGEAPMYPSN
    USA300_FPR3757  LMQVPSGMLAEKFGPRKMITIALVWWSAFTILTGMIKNHGLIYLVRFLFGVGEAPMYPSN
                    ************************************************************

    COL             AVFNSFWFSKNEKGRASSALLAGSYFGPVLAPIVTIAIVNAFNWQAVFYIFGAVGILMAV
    N315            AVFNSFWFSKNEKGRASSALLAGSYFGPVLAPIVTIAIVNAFNWQAVFYIFGAVGILMAV
    NCTC8325        AVFNSFWFSKNEKGRASSALLAGSYFGPVLAPIVTIAIVNAFNWQAVFYIFGAVGILMAV
    Newman          AVFNSFWFSKNEKGRASSALLAGSYFGPVLAPIVTIAIVNAFNWQAVFYIFGAVGILMAV
    USA300_FPR3757  AVFNSFWFSKNEKGRASSALLAGSYFGPVLAPIVTIAIVNAFNWQAVFYIFGAVGILMAV
                    ************************************************************

    COL             LWAIIAKDLPEQHRMVNEAEKRFIMENRDIVATEKSSPPWNDFFKRFSFYAIAIQYFVVQ
    N315            LWAIIAKDLPEQHRMVNEAEKRFIMENRDIVATEKSSPPWNNFFKRFSFYAIAIQYFVVQ
    NCTC8325        LWAIIAKDLPEQHRMVNEAEKRFIMENRDIVATEKSSPPWNDFFKRFSFYAIAIQYFVVQ
    Newman          LWAIIAKDLPEQHRMVNEAEKRFIMENRDIVATEKSSPPWNDFFKRFSFYAIAIQYFVVQ
    USA300_FPR3757  LWAIIAKDLPEQHRMVNEAEKRFIMENRDIVATEKSSPPWNDFFKRFSFYAIAIQYFVVQ
                    *****************************************:******************

    COL             FIITLFLIWLPTYLTEVFHVNFKEMSISSLPWLLMFFLILSAGAISDRVLGLGRSKFVAR
    N315            FIITLFLIWLPTYLTEVFHVNFKEMSISSLPWLLMFFLILSAGAISDRVLGLGRSKFVAR
    NCTC8325        FIITLFLIWLPTYLTEVFHVNFKEMSISSLPWLLMFFLILSAGAISDRVLGLGRSKFVAR
    Newman          FIITLFLIWLPTYLTEVFHVNFKEMSISSLPWLLMFFLILSAGAISDRVLGLGRSKFVAR
    USA300_FPR3757  FIITLFLIWLPTYLTEVFHVNFKEMSISSLPWLLMFFLILSAGAISDRVLGLGRSKFVAR
                    ************************************************************

    COL             GVIAIAGFIVFAVSIIFAVRTGNLYVSIFWLSLGLGGIGISMGMSWAAATDLGRNFSGTV
    N315            GVIAIAGFIVFAVSIIFAVRTGNLYVSIFWLSLGLGGIGISMGMSWAAATDLGRNFSGTV
    NCTC8325        GVIAIAGFIVFAVSIIFAVRTGNLYVSIFWLSLGLGGIGISMGMSWAAATDLGRNFSGTV
    Newman          GVIAIAGFIVFAVSIIFAVRTGNLYVSIFWLSLGLGGIGISMGMSWAAATDLGRNFSGTV
    USA300_FPR3757  GVIAIAGFIVFAVSIIFAVRTGNLYVSIFWLSLGLGGIGISMGMSWAAATDLGRNFSGTV
                    ************************************************************

    COL             SGWMNLWGNIGALISPLLAGLFVEHLGWTMTFQLLIVPAVIAVIMWFYVKPDQPLIVSDD
    N315            SGWMNLWGNIGALISPLLAGLFVEHLGWTMTFQLLIVPAVIAVIMWFYVKPDQPLIVSDD
    NCTC8325        SGWMNLWGNIGALISPLLAGLFVEHLGWTMTFQLLIVPAVIAVIMWFYVKPDQPLIVSDD
    Newman          SGWMNLWGNIGALISPLLAGLFVEHLGWTMTFQLLIVPAVIAVIMWFYVKPDQPLIVSDD
    USA300_FPR3757  SGWMNLWGNIGALISPLLAGLFVEHLGWTMTFQLLIVPAVIAVIMWFYVKPDQPLIVSDD
                    ************************************************************

    COL             KAIEK
    N315            KAIEK
    NCTC8325        KAIEK
    Newman          KAIEK
    USA300_FPR3757  KAIEK
                    *****