From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006149000
  • symbol?:
  • description?: MarR family transcriptional regulator

      descriptions from strain specific annotations:

    • MarR family transcriptional regulator
    • transcriptional regulator MarR family protein
    • iron dependent repressor, N-terminal DNA binding domain protein
    • MarR family regulatory protein
    • pseudogene
    • transcriptional regulator, MarR family
  • strand?: -
  • coordinates?: 6221313..6221828
  • synteny block?: BlockID0048790
  • occurrence?: in 56% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    C248_2569 (yvnA)
    11819-97:
    MS7_2518
    71193:
    ST398NM01_2565
    ECT-R 2:
    ED133:
    SAOV_2557c
    ED98:
    HO 5096 0412:
    SAEMRSA15_24110
    JH1:
    JH9:
    JKD6008:
    SAA6008_02550
    JKD6159:
    SAA6159_02409
    LGA251:
    SARLGA251_22880
    M013:
    MRSA252:
    MSHR1132:
    SAMSHR1132_23340
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    SAPIG2565
    T0131:
    SAT0131_02715
    TCH60:
    TW20:
    SATW20_26340
    USA300_TCH1516:
    USA300HOU_2502
    VC40:
    SAVC_11440

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDMKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSE
    NCTC8325        --MKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSE
    Newman          --MKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSE
    USA300_FPR3757  MDMKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSE
                      **********************************************************

    COL             MLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKY
    NCTC8325        MLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKY
    Newman          MLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKY
    USA300_FPR3757  MLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKY
                    ************************************************************

    COL             EEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND
    NCTC8325        EEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND
    Newman          EEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND
    USA300_FPR3757  EEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND
                    **********************************