From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2524 [new locus tag: SACOL_RS13220 ]
  • pan locus tag?: SAUPAN006149000
  • symbol: SACOL2524
  • pan gene symbol?:
  • synonym:
  • product: MarR family transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SACOL2524 [new locus tag: SACOL_RS13220 ]
  • symbol: SACOL2524
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2585246..2585710
  • length: 465
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    GTGGATATGAAGAGAGAAGTTATTTTAAAATTACAACAATTTATTATAGAAAGAGAAAAT
    GCCGATAAAAGAAGACAGTATAAAAAGGAAAATGAGGAACTAGATTTATCTCTAACACAA
    TTTCATATCATAGAGTTGATTGATAATAATGATAAAGTGAATAATAAATTTTTGTCTGAA
    ATGTTAAATGTATCAAAACCAGCAATTACTAAATCGATAAAAAAACTTTTAGCGAAAGAC
    TTAGTAGTTGAATCGCACAATGAATTTAACAAAAGAGAAGTTAATTATTCATTAACACAA
    AAAGGAAAAAAATTATCTTATATACATGATGAATTACATGAAAAATCGGTAAAAAAATAT
    GAAGAGGTACTTAAAGTCTTTGATGATGATGAAATGGCAGTTATTATAGAGTTTTTAAAC
    CGTAGTATAGAAGAATTAAAAAAAGAAGATGGTTTAAATGATTAA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SACOL2524 [new locus tag: SACOL_RS13220 ]
  • symbol: SACOL2524
  • description: MarR family transcriptional regulator
  • length: 154
  • theoretical pI: 5.75246
  • theoretical MW: 18325.9
  • GRAVY: -0.766234

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 39.9)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 20.6)
    Signal transductionRegulatory functionsDNA interactionsstaphylococcal accessory regulator family (TIGR01889; HMM-score: 20.3)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 17)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtheriron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.5)
    Signal transductionRegulatory functionsDNA interactionsiron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.5)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.2)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.7)
  • TheSEED:  
    Transcriptional regulator, MarR family 
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 47.4)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 37.8)
    MarR_2; MarR family (PF12802; HMM-score: 33.1)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 29.8)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 26.5)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 24.8)
    HTH_11; HTH domain (PF08279; HMM-score: 24.7)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 22.1)
    HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 18.7)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.5)
    no clan definedPhage_rep_O; Bacteriophage replication protein O (PF04492; HMM-score: 14.7)
    Pep3_Vps18; Pep3/Vps18/deep orange family (PF05131; HMM-score: 14.4)
    TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 14.3)
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 13.2)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.8)
    no clan definedSieB; Super-infection exclusion protein B (PF14163; HMM-score: 9.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 27
    • Cmax: 0.105
    • Cmax_pos: 22
    • Smax: 0.272
    • Smax_pos: 20
    • Smean: 0.122
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDMKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSEMLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKYEEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND

Experimental data[edit source | edit]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int. J. Med. Microbiol.: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]