From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006167000
  • symbol?:
  • description?: glyoxalase/bleomycin resistance protein/dioxygenase

      descriptions from strain specific annotations:

    • glyoxalase/bleomycin resistance protein/dioxygenase
    • glyoxalase family protein
    • glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein
    • pseudogene
  • strand?: +
  • coordinates?: 6238611..6239417
  • synteny block?: BlockID0048920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2458
    08BA02176:
    C248_2580
    11819-97:
    MS7_2528
    71193:
    ST398NM01_2574
    ECT-R 2:
    ECTR2_2374
    ED133:
    SAOV_2566
    ED98:
    SAAV_2587
    HO 5096 0412:
    SAEMRSA15_24200
    JH1:
    SaurJH1_2597
    JH9:
    SaurJH9_2545
    JKD6008:
    SAA6008_02560
    JKD6159:
    SAA6159_02418
    LGA251:
    SARLGA251_22970
    M013:
    M013TW_2494
    MRSA252:
    SAR2602
    MSHR1132:
    SAMSHR1132_23430
    MSSA476:
    SAS2407
    Mu3:
    SAHV_2506
    Mu50:
    SAV2522
    MW2:
    MW2442
    RF122:
    SAB2396
    ST398:
    SAPIG2574
    T0131:
    SAT0131_02724 (sasA)
    TCH60:
    HMPREF0772_10671
    TW20:
    SATW20_26430
    USA300_TCH1516:
    USA300HOU_2511
    VC40:
    SAVC_11485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAFHDKTATQVTNIVLNVRDLDLMTTFYKNILGLSVKSSDDNTTVLSVGTGGHTLTLHLL
    N315            MAFHDKTATQVTNIELNVRDLDLMTTFYKNILGLSVKSSDDNTTVLSVGTGGHTLTLHLL
    NCTC8325        MAFHDKTATQVTNIVLNVRDLDLMTTFYKNILGLSVKSSDDNTTVLSVGTGGHTLTLHLL
    Newman          MAFHDKTATQVTNIVLNVRDLDLMTTFYKNILGLSVKSSDDNTTVLSVGTGGHTLTLHLL
    USA300_FPR3757  MAFHDKTATQVTNIVLNVRDLDLMTTFYKNILGLSVKSSDDNTTVLSVGTGGHTLTLHLL
                    ************** *********************************************

    COL             EDGRQTSPREAGLFHIAFLLPTTEDLANFLYFVAQKNMGIGAGDHLVSEALYFNDPEGNG
    N315            EDGRQTSPREAGLFHIAFLLPTTEDLANFLYFVAQKNMGIGAGDHLVSEALYFNDPEGNG
    NCTC8325        EDGRQTSPREAGLFHIAFLLPTTEDLANFLYFVAQKNMGIGAGDHLVSEALYFNDPEGNG
    Newman          EDGRQTSPREAGLFHIAFLLPTTEDLANFLYFVAQKNMGIGAGDHLVSEALYFNDPEGNG
    USA300_FPR3757  EDGRQTSPREAGLFHIAFLLPTTEDLANFLYFVAQKNMGIGAGDHLVSEALYFNDPEGNG
                    ************************************************************

    COL             IEVYRDRPSSSWEWQNGKVKMDTLEVDSQTLLTHRTDEGWQGMPAKGMIGHLHLKTHDLD
    N315            IEVYRDRPSSSWEWQNGKVKMDTLEVDSQTLLTHRTDEGWQGMPAKGMIGHLHLKTHDLD
    NCTC8325        IEVYRDRPSSSWEWQNGKVKMDTLEVDSQTLLTHRTDEGWQGMPAKGMIGHLHLKTHDLD
    Newman          IEVYRDRPSSSWEWQNGKVKMDTLEVDSQTLLTHRTDEGWQGMPAKGMIGHLHLKTHDLD
    USA300_FPR3757  IEVYRDRPSSSWEWQNGKVKMDTLEVDSQTLLTHRTDEGWQGMPAKGMIGHLHLKTHDLD
                    ************************************************************

    COL             AAYQCYIEQLGFQHVSDFPRALFMSTNHYHHHIAANTWQSNQARQNNSQSYGLTHVDIYQ
    N315            AAYQCYIEQLGFQHVSDFPRALFMSTNHYHHHIAANTWQSNQARQNNAQSYGLTHVDIYQ
    NCTC8325        AAYQCYIEQLGFQHVSDFPRALFMSTNHYHHHIAANTWQSNQARQNNSQSYGLTHVDIYQ
    Newman          AAYQCYIEQLGFQHVSDFPRALFMSTNHYHHHIAANTWQSNQARQNNSQSYGLTHVDIYQ
    USA300_FPR3757  AAYQCYIEQLGFQHVSDFPRALFMSTNHYHHHIAANTWQSNQARQNNSQSYGLTHVDIYQ
                    ***********************************************:************

    COL             PDASTHTFTAPEGFDITVHSNTDLVPEK
    N315            PDASTHTFTAPEGFDITVHSNTDLVPEK
    NCTC8325        PDASTHTFTAPEGFDITVHSNTDLVPEK
    Newman          PDASTHTFTAPEGFDITVHSNTDLVPEK
    USA300_FPR3757  PDASTHTFTAPEGFDITVHSNTDLVPEK
                    ****************************