From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006188000
  • symbol?:
  • description?: EamA family transporter

      descriptions from strain specific annotations:

    • EamA family transporter
    • DMT superfamily drug/metabolite transporter
    • drug/metabolite exporter family transporter
    • EamA family protein
    • eamA-like transporter family protein
    • transporter, EamA family
  • strand?: +
  • coordinates?: 6251102..6252064
  • synteny block?: BlockID0049130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2470
    08BA02176:
    C248_2591
    11819-97:
    MS7_2539
    71193:
    ST398NM01_2584
    ECT-R 2:
    ECTR2_2386
    ED133:
    SAOV_2578
    ED98:
    SAAV_2600
    HO 5096 0412:
    SAEMRSA15_24330
    JH1:
    SaurJH1_2610
    JH9:
    SaurJH9_2557
    JKD6008:
    SAA6008_02571
    JKD6159:
    SAA6159_02430
    LGA251:
    SARLGA251_23090
    M013:
    M013TW_2506
    MRSA252:
    SAR2614
    MSHR1132:
    SAMSHR1132_23540
    MSSA476:
    SAS2420
    Mu3:
    SAHV_2518
    Mu50:
    SAV2534
    MW2:
    MW2455
    RF122:
    SAB2408
    ST398:
    SAPIG2584
    T0131:
    SAT0131_02739
    TCH60:
    HMPREF0772_10657
    TW20:
    SATW20_26550
    USA300_TCH1516:
    USA300HOU_2524
    VC40:
    SAVC_11545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLVLSFKGVRYLANNHSALRLKGIILAIVGACLWGLGGTVSDFLFKYKNINVDWYVTAR
    N315            ------------MANNHSALRLKGIILAIVGACLWGLGGTVSDFLFKYKNINVDWYVTAR
    NCTC8325        ---------MRYLANNHSALRLKGIILAIVGACLWGLGGTVSDFLFKYKNINVDWYVTAR
    Newman          ------------MANNHSALRLKGIILAIVGACLWGLGGTVSDFLFKYKNINVDWYVTAR
    USA300_FPR3757  MLLVLSFKGVRYLANNHSALRLKGIILAIVGACLWGLGGTVSDFLFKYKNINVDWYVTAR
                                :***********************************************

    COL             LVVSGVFLLIMYKMMQPKRSIFSVFQDRRMLGKLLIFSILGMLVVQYAYMASINTGNAAI
    N315            LVVSGVFLLIMYKMMQPKRSIFSVFQDRRMLGKLLIFSILGMLVVQYAYMASINTGNAAI
    NCTC8325        LVVSGVFLLIMYKMMQPKRSIFSVFQDRRMLGKLLIFSILGMLVVQYAYMASINTGNAAI
    Newman          LVVSGVFLLIMYKMMQPKRSIFSVFQDRRMLGKLLIFSILGMLVVQYAYMASINTGNAAI
    USA300_FPR3757  LVVSGVFLLIMYKMMQPKRSIFSVFQDRRMLGKLLIFSILGMLVVQYAYMASINTGNAAI
                    ************************************************************

    COL             ATLLQYIAPVYIIIWFVIRGVAKLTLFDVLAIIMTLLGTFLLLTNGSFSNLVVNPASLFW
    N315            ATLLQYIAPVYIIIWFVIRGVAKLTLFDVLAIIMTLLGTFLLLTNGSFSNLVVNPASLFW
    NCTC8325        ATLLQYIAPVYIIIWFVIRGVAKLTLFDVLAIIMTLLGTFLLLTNGSFSNLVVNPASLFW
    Newman          ATLLQYIAPVYIIIWFVIRGVAKLTLFDVLAIIMTLLGTFLLLTNGSFSNLVVNPASLFW
    USA300_FPR3757  ATLLQYIAPVYIIIWFVIRGVAKLTLFDVLAIIMTLLGTFLLLTNGSFSNLVVNPASLFW
                    ************************************************************

    COL             GILAGVALAFYTIYPSDLLNRFGSILIVGWAMLISGVAMNLRHPIWHIDITKWDISIILF
    N315            GILAGVALAFYTIYPSDLLNRFGSILIVGWAMLISGVAMNLRHPIWHIDITKWDISIILF
    NCTC8325        GILAGVALAFYTIYPSDLLNRFGSILIVGWAMLISGVAMNLRHPIWHIDITKWDISIILF
    Newman          GILAGVALAFYTIYPSDLLNRFGSILIVGWAMLISGVAMNLRHPIWHIDITKWDISIILF
    USA300_FPR3757  GILAGVALAFYTIYPSDLLNRFGSILIVGWAMLISGVAMNLRHPIWHIDITKWDISIILF
                    ************************************************************

    COL             LIFGIIGGTALAFYFFIDSLQYISAKETTLFGTVEPVVAVIASSLWLHVAFKPFQIVGII
    N315            LIFGIIGGTALAFYFFIDSLQYISAKETTLFGTVEPVVAVIASSLWLHVAFKPFQIVGII
    NCTC8325        LIFGIIGGTALAFYFFIDSLQYISAKETTLFGTVEPVVAVIASSLWLHVAFKPFQIVGII
    Newman          LIFGIIGGTALAFYFFIDSLQYISAKETTLFGTVEPVVAVIASSLWLHVAFKPFQIVGII
    USA300_FPR3757  LIFGIIGGTALAFYFFIDSLQYISAKETTLFGTVEPVVAVIASSLWLHVAFKPFQIVGII
                    ************************************************************

    COL             LIMILILLLSLKRQPETLDE
    N315            LIMILILLLSLKRQPEALDE
    NCTC8325        LIMILILLLSLKRQPETLDE
    Newman          LIMILILLLSLKRQPETLDE
    USA300_FPR3757  LIMILILLLSLKRQPETLDE
                    ****************:***