From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006197000
  • symbol?: cidB
  • description?: CidA-associated membrane protein CidB

      descriptions from strain specific annotations:

    • CidA-associated membrane protein CidB
    • lrgB-like family protein
    • holin-like protein CidB
    • putative murein hydrolase subunit LrgB_1
  • strand?: -
  • coordinates?: 6260364..6261053
  • synteny block?: BlockID0049210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2439 (cidB)
    USA300_FPR3757:
    04-02981:
    SA2981_2476 (cidB)
    08BA02176:
    C248_2597
    11819-97:
    MS7_2545 (cidB)
    71193:
    ST398NM01_2590
    ECT-R 2:
    ECTR2_2392
    ED133:
    SAOV_2584c
    ED98:
    SAAV_2606
    HO 5096 0412:
    SAEMRSA15_24430
    JH1:
    SaurJH1_2616
    JH9:
    SaurJH9_2563
    JKD6008:
    SAA6008_02577 (lrgB_1)
    JKD6159:
    SAA6159_02436 (lrgB_1)
    LGA251:
    SARLGA251_23150 (cidB)
    M013:
    M013TW_2512
    MRSA252:
    SAR2620
    MSHR1132:
    SAMSHR1132_23600
    MSSA476:
    SAS2426
    Mu3:
    SAHV_2524
    Mu50:
    SAV2540
    MW2:
    MW2461
    RF122:
    SAB2414c
    ST398:
    SAPIG2590
    T0131:
    SAT0131_02746 (glpP)
    TCH60:
    HMPREF0772_10651
    TW20:
    SATW20_26610 (cidB)
    USA300_TCH1516:
    USA300HOU_2532
    VC40:
    SAVC_11575

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG
    N315            MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG
    NCTC8325        MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG
    Newman          MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG
    USA300_FPR3757  MNDYVQALLMILLTVVLYYFAKRLQQKYPNPFLNPALIASLGIIFVLLIFGISYNGYMKG
                    ************************************************************

    COL             GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD
    N315            GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD
    NCTC8325        GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD
    Newman          GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD
    USA300_FPR3757  GSWINHILNATVVCLAYPLYKNREKIKDNVSIIFASVLTGVMLNFMLVFLTLKAFGYSKD
                    ************************************************************

    COL             VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG
    N315            VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG
    NCTC8325        VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG
    Newman          VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG
    USA300_FPR3757  VIVTLLPRSITAAVGIEVSHELGGTDTMTVLFIITTGLIGSILGSMLLRFGRFESSIAKG
                    ************************************************************

    COL             LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY
    N315            LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY
    NCTC8325        LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY
    Newman          LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY
    USA300_FPR3757  LTYGNASHAFGTAKALEMDIESGAFSSIGMILTAVISSVLIPVLILLFY
                    *************************************************