From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006214000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • MmpL efflux pump
    • antibiotic transport-associated protein-like protein
    • Putative antibiotic transport-associated protein
    • antibiotic ABC transporter
    • membrane protein YdfJ
    • membrane transporter
    • MMPL domain-containing protein
    • mmpl domain protein
    • MmpL efflux pump, putative
    • MMPL family protein
    • MMPL family transporter
    • putative transport protein
    • resistance-nodulation-cell division acriflavin:proton (H+) antiporter
    • RND superfamily resistance-nodulation-cell division:proton (H+) antiporter
    • transport protein
  • strand?: -
  • coordinates?: 6275136..6277553
  • synteny block?: BlockID0049380
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2488
    08BA02176:
    C248_2609
    11819-97:
    MS7_2558
    71193:
    ST398NM01_2602
    ECT-R 2:
    ECTR2_2404
    ED133:
    SAOV_2596c
    ED98:
    SAAV_2618
    HO 5096 0412:
    SAEMRSA15_24550
    JH1:
    SaurJH1_2628
    JH9:
    SaurJH9_2574
    JKD6008:
    SAA6008_02590
    JKD6159:
    SAA6159_02448
    LGA251:
    SARLGA251_23270
    M013:
    M013TW_2525
    MRSA252:
    SAR2632
    MSHR1132:
    SAMSHR1132_23720
    MSSA476:
    SAS2438
    Mu3:
    SAHV_2536
    Mu50:
    SAV2552
    MW2:
    MW2473
    RF122:
    SAB2426c
    ST398:
    SAPIG2602
    T0131:
    SAT0131_02762
    TCH60:
    HMPREF0772_10639 (ydfJ)
    TW20:
    SATW20_26740
    USA300_TCH1516:
    USA300HOU_2546
    VC40:
    SAVC_11640

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKFLYKMGTFIAKHKWSAVIAWIVIVAAILIPLATNAPKFDNDIKMTGLESLDTNKKIE
    N315            MAKFLYKMGTFIAKHKWSAVIAWIVIVAAILIPLATNAPKFDNDIKMTGLESLDTNKKIE
    NCTC8325        -------MGTFIAKHKWSAVIAWIVIVAAILIPLATNAPKFDNDIKMTGLESLDTNKKIE
    Newman          MAKFLYKMGTFIAKHKWSAVIAWIVIVAAILIPLATNAPKFDNDIKMTGLESLDTNKKIE
    USA300_FPR3757  -------MGTFIAKHKWSAVIAWIVIVAAILIPLATNAPKFDNDIKMTGLESLDTNKKIE
                           *****************************************************

    COL             KHFNQDSEKAQIRVVFKTTKDDGIVQPNITKDIKKTLDDIKKDDKHIDKISDPYENKQIS
    N315            KHFNQDSEKAQIRVVFKTTKDDGIVQPNITEDIKKTLEDIKKDDKHIDKISDPYENKQIS
    NCTC8325        KHFNQDSEKAQIRVVFKTTKDDGIVQPNITKDIKKTLDDIKKDDKHIDKISDPYENKQIS
    Newman          KHFNQDSEKAQIRVVFKTTKDDGIVQPNITKDIKKTLDDIKKDDKHIDKISDPYENKQIS
    USA300_FPR3757  KHFNQDSEKAQIRVVFKTTKDDGIVQPNITKDIKKTLDDIKKDDKHIDKISDPYENKQIS
                    ******************************:******:**********************

    COL             KDKTTAFADITYDVSQTSLKDGSRDNVKSHLKDLRDNHNVQTELTGTGMTSTEVGGNSEL
    N315            KDKTTAFADITYDVSQTSLKDGSRDNVKSHLKDLRDNHNVQTELTGTGMTSTEVGGNSEL
    NCTC8325        KDKTTAFADITYDVSQTSLKDGSRDNVKSHLKDLRDNHNVQTELTGTGMTSTEVGGNSEL
    Newman          KDKTTAFADITYDVSQTSLKDGSRDNVKSHLKDLRDNHNVQTELTGTGMTSTEVGGNSEL
    USA300_FPR3757  KDKTTAFADITYDVSQTSLKDGSRDNVKSHLKDLRDNHNVQTELTGTGMTSTEVGGNSEL
                    ************************************************************

    COL             VGIIVAFVVLLITFGSVIAAGLPIISALIGLASGVGIISLLTYAFDIPNVTLTLAVMIGL
    N315            VGIIVAFVVLLITFGSVIAAGLPIISALIGLASGVGIISLLTYAFDIPNVTLTLAVMIGL
    NCTC8325        VGIIVAFVVLLITFGSVIAAGLPIISALIGLASGVGIISLLTYAFDIPNVTLTLAVMIGL
    Newman          VGIIVAFVVLLITFGSVIAAGLPIISALIGLASGVGIISLLTYAFDIPNVTLTLAVMIGL
    USA300_FPR3757  VGIIVAFVVLLITFGSVIAAGLPIISALIGLASGVGIISLLTYAFDIPNVTLTLAVMIGL
                    ************************************************************

    COL             AVGIDYALFILFRYRQVMKTETDYIKGIGLAIGTAGSAVVFAGVTVVIAVCGLSLVGIDF
    N315            AVGIDYALFILFRYRQVMKTETDYIKGIGLAIGTAGSAVVFAGVTVVIAVCGLSLVGIDF
    NCTC8325        AVGIDYALFILFRYRQVMKTETDYIKGIGLAIGTAGSAVVFAGVTVVIAVCGLSLVGIDF
    Newman          AVGIDYALFILFRYRQVMKTETDYIKGIGLAIGTAGSAVVFAGVTVVIAVCGLSLVGIDF
    USA300_FPR3757  AVGIDYALFILFRYRQVMKTETDYIKGIGLAIGTAGSAVVFAGVTVVIAVCGLSLVGIDF
                    ************************************************************

    COL             LAVMGFASAISVVFAVLSALTLLPALISIFHKRIKVNKLQSKFKKDIDTPWSKFITGNAL
    N315            LAVMGFASAISVIFAVFSALTLLPALISIFHKRIKVNKLQSNFKKDIDTPWSKFITGNAL
    NCTC8325        LAVMGFASAISVVFAVLSALTLLPALISIFHKRIKVNKLQSKFKKDIDTPWSKFITGNAL
    Newman          LAVMGFASAISVVFAVLSALTLLPALISIFHKRIKVNKLQSKFKKDIDTPWSKFITGNAL
    USA300_FPR3757  LAVMGFASAISVVFAVLSALTLLPALISIFHKRIKVNKLQSKFKKDIDTPWSKFITGNAL
                    ************:***:************************:******************

    COL             AAVLLGLIILVAAAIPVSHMRLGIPDDGVKPADSTQKKAYDIISDKFGEGFNGQIPMLIN
    N315            AAVLLGLIILVAAAIPVSHMRLGIPDDGVKPADSTQKKAYDIISDKFGEGFNGQIPMLIN
    NCTC8325        AAVLLGLIILVAAAIPVSHMRLGIPDDGVKPADSTQKKAYDIISDKFGEGFNGQIPMLIN
    Newman          AAVLLGLIILVAAAIPVSHMRLGIPDDGVKPADSTQKKAYDIISDKFGEGFNGQIPMLIN
    USA300_FPR3757  AAVLLGLIILVAAAIPVSHMRLGIPDDGVKPADSTQKKAYDIISDKFGEGFNGQIPMLIN
                    ************************************************************

    COL             VKDKKDDPQGLQQDLQSVYKDIKDKKNVDIVTPPQMSKDNDYALMVVIPKQGPNAESTND
    N315            VKDKKDDPQGLQQDLQSVYKDIKDKKNVDIVTPPQMSKDNDYALMVVIPKQGPNAESTND
    NCTC8325        VKDKKDDPQGLQQDLQSVYKDIKDKKNVDIVTPPQMSKDNDYALMVVIPKQGPNAESTND
    Newman          VKDKKDDPQGLQQDLQSVYKDIKDKKNVDIVTPPQMSKDNDYALMVVIPKQGPNAESTND
    USA300_FPR3757  VKDKKDDPQGLQQDLQSVYKDIKDKKNVDIVTPPQMSKDNDYALMVVIPKQGPNAESTND
                    ************************************************************

    COL             LVHDLRDYHKDAQDKYGFKTEISGQSVINIDMSKKLNEAIPLFASVIVVLAFFLLMIVFR
    N315            LVHDLRDYHKDAQDKYGFKTEISGQSVINIDMSKKLNEAIPLFATVIVVLAFFLLMIVFR
    NCTC8325        LVHDLRDYHKDAQDKYGFKTEISGQSVINIDMSKKLNEAIPLFASVIVVLAFFLLMIVFR
    Newman          LVHDLRDYHKDAQDKYGFKTEISGQSVINIDMSKKLNEAIPLFASVIVVLAFFLLMIVFR
    USA300_FPR3757  LVHDLRDYHKDAQDKYGFKTEISGQSVINIDMSKKLNEAIPLFASVIVVLAFFLLMIVFR
                    ********************************************:***************

    COL             SILIPLKAVLGFVLSLMATLGFTTLVMQDGFMKGLFGIETTGPMLAFLPVITIGILFGLA
    N315            SILIPLKAVLGFVLSLMATLGFTTLVMQDGFMKGLFGIETTGPMLAFLPVITIGILFGLA
    NCTC8325        SILIPLKAVLGFVLSLMATLGFTTLVMQDGFMKGLFGIETTGPMLAFLPVITIGILFGLA
    Newman          SILIPLKAVLGFVLSLMATLGFTTLVMQDGFMKGLFGIETTGPMLAFLPVITIGILFGLA
    USA300_FPR3757  SILIPLKAVLGFVLSLMATLGFTTLVMQDGFMKGLFGIETTGPMLAFLPVITIGILFGLA
                    ************************************************************

    COL             MDYEVFLMSRIHEEYSKTGDNDYSIKVGLKESGPVIVAAALIMFSVFFAFVFQEDVMIKS
    N315            MDYEVFLMSRIHEEYSKTGDNDYSIKVGLKESGPVIVAAALIMFSVFFAFVFQEDVMIKS
    NCTC8325        MDYEVFLMSRIHEEYSKTGDNDYSIKVGLKESGPVIVAAALIMFSVFFAFVFQEDVMIKS
    Newman          MDYEVFLMSRIHEEYSKTGDNDYSIKVGLKESGPVIVAAALIMFSVFFAFVFQEDVMIKS
    USA300_FPR3757  MDYEVFLMSRIHEEYSKTGDNDYSIKVGLKESGPVIVAAALIMFSVFFAFVFQEDVMIKS
                    ************************************************************

    COL             MGMALAFGVLFDAFVVRMMLIPALTKLFGKGSWYLPAWLNRIIPRVDIEGHALEKYKTVE
    N315            MGMALAFGVLFDAFVVRMMLIPALTKLFGKGSWYLPAWLNRIIPRVDIEGHALEKYKTVE
    NCTC8325        MGMALAFGVLFDAFVVRMMLIPALTKLFGKGSWYLPAWLNRIIPRVDIEGHALEKYKTVE
    Newman          MGMALAFGVLFDAFVVRMMLIPALTKLFGKGSWYLPAWLNRIIPRVDIEGHALEKYKTVE
    USA300_FPR3757  MGMALAFGVLFDAFVVRMMLIPALTKLFGKGSWYLPAWLNRIIPRVDIEGHALEKYKTVE
                    ************************************************************

    COL             SQESEAKDSKETYDTTFKVYPQGATNVSKHQDAHGQDDAHSIVLDDKTMALYQEVKQQSA
    N315            SQESEAKDSKETYDTTFKVYPQGATNVSKHQDVHGQDDAHSIVLDDKTMALYQEVKQQSA
    NCTC8325        SQESEAKDSKETYDTTFKVYPQGATNVSKHQDAHGQDDAHSIVLDDKTMALYQEVKQQSA
    Newman          SQESEAKDSKETYDTTFKVYPQGATNVSKHQDAHGQDDAHSIVLDDKTMALYQEVKQQSA
    USA300_FPR3757  SQESEAKDSKETYDTTFKVYPQGATNVSKHQDAHGQDDAHSIVLDDKTMALYQEVKQQSA
                    ********************************.***************************

    COL             SSLFLYDALIDYQNKHQLNSKQQATNIEQLNKNIEKLNQLLEKNLRNKS
    N315            SSLFLYDALIDYQNKHQLNSKQQVTNIEQLNKNIEKLNQLLEKNLRNKS
    NCTC8325        SSLFLYDALIDYQNKHQLNSKQQATNIEQLNKNIEKLNQLLEKNLRNKS
    Newman          SSLFLYDALIDYQNKHQLNSKQQATNIEQLNKNIEKLNQLLEKNLRNKS
    USA300_FPR3757  SSLFLYDALIDYQNKHQLNSKKQATNIEQLNKNIEKLNQLLEKNLRNKS
                    *********************:*.*************************