From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006217000
  • symbol?: rocA
  • description?: 1-pyrroline-5-carboxylate dehydrogenase

      descriptions from strain specific annotations:

    • 1-pyrroline-5-carboxylate dehydrogenase
    • Delta-1-pyrroline-5-carboxylate dehydrogenase
    • putative delta-1-pyrroline-5-carboxylate dehydrogenase
    • aldehyde dehydrogenase family protein
    • delta-1-pyrroline-5-carboxylate dehydrogenase, putative
  • strand?: -
  • coordinates?: 6278675..6280219
  • synteny block?: BlockID0049410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2341 (rocA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2491 (rocA)
    08BA02176:
    C248_2612
    11819-97:
    MS7_2561 (pruA)
    71193:
    ST398NM01_2605
    ECT-R 2:
    ECTR2_2407 (pruA)
    ED133:
    SAOV_2599c
    ED98:
    SAAV_2620
    HO 5096 0412:
    SAEMRSA15_24570
    JH1:
    SaurJH1_2630
    JH9:
    SaurJH9_2576
    JKD6008:
    SAA6008_02593 (rocA)
    JKD6159:
    SAA6159_02450 (rocA)
    LGA251:
    SARLGA251_23290
    M013:
    M013TW_2528
    MRSA252:
    SAR2634
    MSHR1132:
    SAMSHR1132_23750
    MSSA476:
    SAS2440
    Mu3:
    SAHV_2538 (rocA)
    Mu50:
    SAV2554 (rocA)
    MW2:
    MW2475 (rocA)
    RF122:
    SAB2428c
    ST398:
    SAPIG2605
    T0131:
    SAT0131_02765 (glnA)
    TCH60:
    HMPREF0772_10636 (rocA)
    TW20:
    SATW20_26760
    USA300_TCH1516:
    USA300HOU_2549
    VC40:
    SAVC_11650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
    N315            MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
    NCTC8325        MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
    Newman          MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
    USA300_FPR3757  MVVEFKNEPGYDFSVQENVDMFKKALKDVEKELGQDIPLVINGEKIFKDDKIKSINPADT
                    ************************************************************

    COL             SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
    N315            SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
    NCTC8325        SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
    Newman          SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
    USA300_FPR3757  SQVIANASKATKQDVEDAFKAANEAYKSWKTWSANDRAELMLRVSAIIRRRKAEIAAIMV
                    ************************************************************

    COL             YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
    N315            YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
    NCTC8325        YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
    Newman          YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
    USA300_FPR3757  YEAGKPWDEAVGDAAEGIDFIEYYARSMMDLAQGKPVLDREGEHNKYFYKSIGTGVTIPP
                    ************************************************************

    COL             WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
    N315            WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
    NCTC8325        WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
    Newman          WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
    USA300_FPR3757  WNFPFAIMAGTTLAPVVAGNTVLLKPAEDTPYIAYKLMEILEEAGLPKGVVNFVPGDPKE
                    ************************************************************

    COL             IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
    N315            IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
    NCTC8325        IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
    Newman          IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
    USA300_FPR3757  IGDYLVDHKDTHFVTFTGSRATGTRIYERSAVVQEGQNFLKRVIAEMGGKDAIVVDENID
                    ************************************************************

    COL             TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
    N315            TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
    NCTC8325        TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
    Newman          TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
    USA300_FPR3757  TDMAAEAIVTSAFGFSGQKCSACSRAIVHKDVYDEVLEKSIKLTKELTLGNTVDNTYMGP
                    ************************************************************

    COL             VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
    N315            VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
    NCTC8325        VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
    Newman          VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
    USA300_FPR3757  VINKKQFDKIKNYIEIGKEEGKLEQGGGTDDSKGYFVEPTIISGLKSKDRIMQEEIFGPV
                    ************************************************************

    COL             VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
    N315            VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
    NCTC8325        VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
    Newman          VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
    USA300_FPR3757  VGFVKVNDFDEAIEVANDTDYGLTGAVITNNREHWIKAVNEFDVGNLYLNRGCTSAVVGY
                    ************************************************************

    COL             HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
    N315            HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
    NCTC8325        HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
    Newman          HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
    USA300_FPR3757  HPFGGFKMSGTDAKTGSPDYLLHFLEQKVVSEMF
                    **********************************