From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006220000
  • symbol?: copA
  • description?: copper-transporting ATPase copA

      descriptions from strain specific annotations:

    • copper-transporting ATPase copA
    • copper-translocating P-type ATPase
    • cation-transporting ATPase E1-E2 family protein
    • cation transporter E1-E2 family ATPase
    • P-ATPase superfamily P-type ATPase copper (Cu2+) transporter
    • copper importing ATPase A
    • putative copper importing ATPase A
    • P-ATPase superfamily P-type ATPase copper transporter
    • Copper-exporting ATPase
    • Copper-exporting P-type ATPase A
  • strand?: +
  • coordinates?: 6281688..6284096
  • synteny block?: BlockID0049440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2344 (copA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2494 (copA)
    08BA02176:
    C248_2615 (copA)
    11819-97:
    MS7_2564
    71193:
    ST398NM01_2608
    ECT-R 2:
    ECTR2_2410
    ED133:
    SAOV_2602
    ED98:
    SAAV_2623
    HO 5096 0412:
    SAEMRSA15_24600 (copA)
    JH1:
    SaurJH1_2633
    JH9:
    SaurJH9_2579
    JKD6008:
    SAA6008_02596 (copA)
    JKD6159:
    SAA6159_02453 (copA)
    LGA251:
    SARLGA251_23320 (copA)
    M013:
    M013TW_2531
    MRSA252:
    SAR2637 (copA)
    MSHR1132:
    SAMSHR1132_23780
    MSSA476:
    SAS2443
    Mu3:
    SAHV_2541 (copA)
    Mu50:
    SAV2557 (copA)
    MW2:
    MW2478 (copA)
    RF122:
    SAB2431 (copA)
    ST398:
    SAPIG2608
    T0131:
    SAT0131_02768
    TCH60:
    HMPREF0772_10633 (copA)
    TW20:
    SATW20_26790 (copA)
    USA300_TCH1516:
    USA300HOU_2552 (copA)
    VC40:
    SAVC_11665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MANTKKTTLDITGMTCAACSNRIEKKLNKLDDVNAQVNLTTEKATVEYNPDQHDVQEFIN
    N315            MANTKKTTLDITGMTCAACSNRIEKKLNKLDDVNAQVNLTTEKATVEYNPDQHDVQEFIN
    NCTC8325        MANTKKTTLDITGMTCAACSNRIEKKLNKLDDVNAQVNLTTEKATVEYNPDQHDVQEFIN
    Newman          MANTKKTTLDITGMTCAACSNRIEKKLNKLDDVNAQVNLTTEKATVEYNPDQHDVQEFIN
    USA300_FPR3757  MANTKKTTLDITGMTCAACSNRIEKKLNKLDDVNAQVNLTTEKATVEYNPDQHDVQEFIN
                    ************************************************************

    COL             TIQHLGYGVAVETVELDITGMTCAACSSRIEKVLNKMDGVQNATVNLTTEQAKVDYYPEE
    N315            TIQHLGYGVTVETVELDITGMTCAACSSRIEKVLNKMNGVQNATVNLTTEQAKVDYYPEE
    NCTC8325        TIQHLGYGVAVETVELDITGMTCAACSSRIEKVLNKMDGVQNATVNLTTEQAKVDYYPEE
    Newman          TIQHLGYGVAVETVELDITGMTCAACSSRIEKVLNKMDGVQNATVNLTTEQAKVDYYPEE
    USA300_FPR3757  TIQHLGYGVAVETVELDITGMTCAACSSRIEKVLNKMDGVQNATVNLTTEQAKVDYYPEE
                    *********:***************************:**********************

    COL             TDADKLVTRIQKLGYDASIKDNNKDQTSRKAEALQHKLIKLIISAVLSLPLLMLMFVHLF
    N315            TDADKLVTRIQKLGYDASIKDNNKDQTSRKAEALQHKLIKLIISAVLSLPLLMLMFVHLF
    NCTC8325        TDADKLVTRIQKLGYDASIKDNNKDQTSRKAEALQHKLIKLIISAVLSLPLLMLMFVHLF
    Newman          TDADKLVTRIQKLGYDASIKDNNKDQTSRKAEALQHKLIKLIISAVLSLPLLMLMFVHLF
    USA300_FPR3757  TDADKLVTRIQKLGYDASIKDNNKDQTSRKAEALQHKLIKLIISAVLSLPLLMLMFVHLF
                    ************************************************************

    COL             NMHIPALFTNPWFQFILATPVQFIIGWQFYVGAYKNLRNGGANMDVLVAVGTSAAYFYSI
    N315            NMHIPALFTNPWFQFILATPVQFIIGWQFYVGAYKNLRNGGANMDVLVAVGTSAAYFYSI
    NCTC8325        NMHIPALFTNPWFQFILATPVQFIIGWQFYVGAYKNLRNGGANMDVLVAVGTSAAYFYSI
    Newman          NMHIPALFTNPWFQFILATPVQFIIGWQFYVGAYKNLRNGGANMDVLVAVGTSAAYFYSI
    USA300_FPR3757  NMHIPALFTNPWFQFILATPVQFIIGWQFYVGAYKNLRNGGANMDVLVAVGTSAAYFYSI
                    ************************************************************

    COL             YEMVRWLNGSTTQPHLYFETSAVLITLILFGKYLEARAKSQTTNALGELLSLQAKEARIL
    N315            YEMVRWLNGSTTQPHLYFETSAVLLTLILFGKYLEARAKSQTTNALGELLSLQAKEARIL
    NCTC8325        YEMVRWLNGSTTQPHLYFETSAVLITLILFGKYLEARAKSQTTNALGELLSLQAKEARIL
    Newman          YEMVRWLNGSTTQPHLYFETSAVLITLILFGKYLEARAKSQTTNALGELLSLQAKEARIL
    USA300_FPR3757  YEMVRWLNGSTTQPHLYFETSAVLITLILFGKYLEARAKSQTTNALGELLSLQAKEARIL
                    ************************:***********************************

    COL             KDGNEVMIPLNEVHVGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTV
    N315            KDGNEVMIPLNEVHVGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTV
    NCTC8325        KDGNEVMIPLNEVHVGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTV
    Newman          KDGNEVMIPLNEVHVGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTV
    USA300_FPR3757  KDGNEVMIPLNEVHVGDTLIVKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTV
                    ************************************************************

    COL             IGSTMNKNGTITMTATKVGGDTALANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIA
    N315            IGSTMNKNGTITMTATKVGGDTALANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIA
    NCTC8325        IGSTMNKNGTITMTATKVGGDTALANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIA
    Newman          IGSTMNKNGTITMTATKVGGDTALANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIA
    USA300_FPR3757  IGSTMNKNGTITMTATKVGGDTALANIIKVVEEAQSSKAPIQRLADIISGYFVPIVVGIA
                    ************************************************************

    COL             LLTFIVWITLVTPGTFEPALVASISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGG
    N315            LLIFIVWITLVTPGTFEPALVASISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGG
    NCTC8325        LLTFIVWITLVTPGTFEPALVASISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGG
    Newman          LLTFIVWITLVTPGTFEPALVASISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGG
    USA300_FPR3757  LLTFIVWITLVTPGTFEPALVASISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGG
                    ** *********************************************************

    COL             EFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDNQTLQLLATAEKDSEHPLAEAIVNYAK
    N315            EFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDNQTLQLLATAEKDSEHPLAEAIVNYAK
    NCTC8325        EFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDNQTLQLLATAEKDSEHPLAEAIVNYAK
    Newman          EFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDNQTLQLLATAEKDSEHPLAEAIVNYAK
    USA300_FPR3757  EFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDNQTLQLLATAEKDSEHPLAEAIVNYAK
                    ************************************************************

    COL             EKQLILTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDISLPKHISDDLTHYERDGK
    N315            EKQLTLTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDISLPKHISDDLTHYERDGK
    NCTC8325        EKQLILTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDISLPKHISDDLTHYERDGK
    Newman          EKQLILTETTTFKAVPGHGIEATIDHHHILVGNRKLMADNDISLPKHISDDLTHYERDGK
    USA300_FPR3757  EKQLILTETTTFKAVPGHGIEATIDHHYILVGNRKLMADNDISLPKHISDDLTHYERDGK
                    **** **********************:********************************

    COL             TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIEVAMLTGDNKNTAQAIAKQVGID
    N315            TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIEVAMLTGDNKNTAQAIAKQVGID
    NCTC8325        TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIEVAMLTGDNKNTAQAIAKQVGID
    Newman          TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIEVAMLTGDNKNTAQAIAKQVGID
    USA300_FPR3757  TAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIEVAMLTGDNKNTAQAIAKQVGID
                    ************************************************************

    COL             TVIADILPEEKAAQIAKLQQQGKKVAMVGDGVNDAPALVKADIGIAIGTGTEVAIEAADI
    N315            TVIADILPEEKAAQIAKLQQQGKKVAMVGDGVNDAPALVKADIGIAIGTGTEVAIEAADI
    NCTC8325        TVIADILPEEKAAQIAKLQQQGKKVAMVGDGVNDAPALVKADIGIAIGTGTEVAIEAADI
    Newman          TVIADILPEEKAAQIAKLQQQGKKVAMVGDGVNDAPALVKADIGIAIGTGTEVAIEAADI
    USA300_FPR3757  TVIADILPEEKAAQIAKLQQQGKKVAMVGDGVNDAPALVKADIGIAIGTGTEVAIEAADI
                    ************************************************************

    COL             TILGGDLMLIPKAIYASKATIRNIRQNLFWAFGYNIAGIPIAALGLLAPWVAGAAMALSS
    N315            TILGGDLMLIPKAIYASKATIRNIRQNLFWAFGYNIAGIPIAALGLLAPWVAGAAMALSS
    NCTC8325        TILGGDLMLIPKAIYASKATIRNIRQNLFWAFGYNIAGIPIAALGLLAPWVAGAAMALSS
    Newman          TILGGDLMLIPKAIYASKATIRNIRQNLFWAFGYNIAGIPIAALGLLAPWVAGAAMALSS
    USA300_FPR3757  TILGGDLMLIPKAIYASKATIRNIRQNLFWAFGYNIAGIPIAALGLLAPWVAGAAMALSS
                    ************************************************************

    COL             VSVVTNALRLKKMRLEPRRKDA
    N315            VSVVTNALRLKKMRLEPRRKDA
    NCTC8325        VSVVTNALRLKKMRLEPRRKDA
    Newman          VSVVTNALRLKKMRLEPRRKDA
    USA300_FPR3757  VSVVTNALRLKKMRLEPRRKDA
                    **********************