From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006227000
  • symbol?: crtQ
  • description?: glycosyl transferase family protein

      descriptions from strain specific annotations:

    • glycosyl transferase family protein
    • glycosyl transferase, group 2 family protein
    • 4,4-diaponeurosporenoate glycosyltransferase
    • glycosyl transferase family 2 family protein
    • putative glycosyl transferase
    • Hpnb
  • strand?: -
  • coordinates?: 6290887..6291969
  • synteny block?: BlockID0049510
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2500
    08BA02176:
    C248_2621
    11819-97:
    MS7_2570 (crtQ)
    71193:
    ST398NM01_2614
    ECT-R 2:
    ECTR2_2416
    ED133:
    SAOV_2608c
    ED98:
    SAAV_2629
    HO 5096 0412:
    SAEMRSA15_24660
    JH1:
    SaurJH1_2639
    JH9:
    SaurJH9_2585
    JKD6008:
    SAA6008_02602
    JKD6159:
    SAA6159_02459
    LGA251:
    SARLGA251_23380
    M013:
    M013TW_2537
    MRSA252:
    SAR2645
    MSHR1132:
    MSSA476:
    SAS2449
    Mu3:
    SAHV_2547
    Mu50:
    SAV2563
    MW2:
    MW2484
    RF122:
    SAB2436c
    ST398:
    SAPIG2614
    T0131:
    SAT0131_02774
    TCH60:
    HMPREF0772_10626
    TW20:
    SATW20_26850
    USA300_TCH1516:
    USA300HOU_2558
    VC40:
    SAVC_11695

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISMKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHL
    N315            ---MKWLSRILTVIVTMSMACGALIFNRRHQLKTKTLNFNHKALTIIIPARNEEKRIGHL
    NCTC8325        ---MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHL
    Newman          ---MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHL
    USA300_FPR3757  ---MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHL
                       ******************************:**************************

    COL             LHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHA
    N315            LHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHA
    NCTC8325        LHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHA
    Newman          LHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHA
    USA300_FPR3757  LHSIIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHA
                    ************************************************************

    COL             CTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTV
    N315            CTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTV
    NCTC8325        CTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTV
    Newman          CTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTV
    USA300_FPR3757  CTNRIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTV
                    ************************************************************

    COL             VGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPV
    N315            VGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPV
    NCTC8325        VGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPV
    Newman          VGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPV
    USA300_FPR3757  VGMNVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPV
                    ************************************************************

    COL             TVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCL
    N315            TVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCL
    NCTC8325        TVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCL
    Newman          TVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCL
    USA300_FPR3757  TVYEGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCL
                    ************************************************************

    COL             SLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTH
    N315            SLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTH
    NCTC8325        SLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTH
    Newman          SLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTH
    USA300_FPR3757  SLKYRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTH
                    ************************************************************

    COL             RYGVVEWKGRQYSISKEQ
    N315            RYGVVEWKGRQYSISKEQ
    NCTC8325        RYGVVEWKGRQYSISKEQ
    Newman          RYGVVEWKGRQYSISKEQ
    USA300_FPR3757  RYGVVEWKGRQYSISKEQ
                    ******************