From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006228000
  • symbol?: crtP
  • description?: diapolycopene oxygenase

      descriptions from strain specific annotations:

    • diapolycopene oxygenase
    • phytoene dehydrogenase
    • 4,4'-diaponeurosporene oxidase
    • phytoene dehydrogenase related protein
    • Phytoene desaturase, neurosporene or lycopene producing / 4,4-diapolycopene oxidase
    • phytoene desaturase family protein
    • putative phytoene dehydrogenase related protein
    • zeta-phytoene desaturase
  • strand?: -
  • coordinates?: 6292020..6293513
  • synteny block?: BlockID0049520
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_2464 (crtI)
    USA300_FPR3757:
    04-02981:
    SA2981_2501
    08BA02176:
    C248_2622
    11819-97:
    MS7_2571 (crtP)
    71193:
    ST398NM01_2615
    ECT-R 2:
    ECTR2_2417 (crtI)
    ED133:
    SAOV_2609c
    ED98:
    SAAV_2630
    HO 5096 0412:
    SAEMRSA15_24670
    JH1:
    SaurJH1_2640
    JH9:
    SaurJH9_2586
    JKD6008:
    SAA6008_02603 (crtI)
    JKD6159:
    SAA6159_02460 (crtI)
    LGA251:
    SARLGA251_23390
    M013:
    M013TW_2538
    MRSA252:
    SAR2646
    MSHR1132:
    MSSA476:
    SAS2450
    Mu3:
    SAHV_2548
    Mu50:
    SAV2564
    MW2:
    MW2485
    RF122:
    SAB2437c
    ST398:
    SAPIG2615
    T0131:
    SAT0131_02775
    TCH60:
    HMPREF0772_10625 (crtI)
    TW20:
    SATW20_26860
    USA300_TCH1516:
    USA300HOU_2559
    VC40:
    SAVC_11700

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKHIIVIGGGLGGISAAIRMAQSGYSVSLYEQNNHIGGKVNRHESDGFGFDLGPSILTM
    N315            MTKHIIVIGGGLGGISAAIRMAQSGYSVSLYEQNTHIGGKVNRHESDGFGFDLGPSILTM
    NCTC8325        MTKHIIVIGGGLGGISAAIRMAQSGYSVSLYEQNNHIGGKVNRHESDGFGFDLGPSILTM
    Newman          MTKHIIVIGGGLGGISAAIRMAQSGYSVSLYEQNNHIGGKVNRHESDGFGFDLGPSILTM
    USA300_FPR3757  MTKHIIVIGGGLGGISAAIRMAQSGYSVSLYEQNNHIGGKVNRHESDGFGFDLGPSILTM
                    **********************************.*************************

    COL             PYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTIDLYEGIKETGQHNAILSKQDIE
    N315            PYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTIDLYEGIKETGQHNAILSKQDIE
    NCTC8325        PYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTIDLYEGIKETGQHNAILSKQDIE
    Newman          PYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTIDLYEGIKETGQHNAILSKQDIE
    USA300_FPR3757  PYIFEKLFEYSKKQMSDYVTIKRLPHQWRSFFPDGTTIDLYEGIKETGQHNAILSKQDIE
                    ************************************************************

    COL             ELQNYLNYTRRIDRITEKGYFNYGLDTLSQIIKFHGPLNALINYDYVHTMQQAIDKRISN
    N315            ELQNYLNYTRRIDRITEKGYFNYGLDTLSQIIKFHGPLNALINYDYVHTMQQAIDKRISN
    NCTC8325        ELQNYLNYTRRIDRITEKGYFNYGLDTLSQIIKFHGPLNALINYDYVHTMQQAIDKRISN
    Newman          ELQNYLNYTRRIDRITEKGYFNYGLDTLSQIIKFHGPLNALINYDYVHTMQQAIDKRISN
    USA300_FPR3757  ELQNYLNYTRRIDRITEKGYFNYGLDTLSQIIKFHGPLNALINYDYVHTMQQAIDKRISN
                    ************************************************************

    COL             PYLRQMLGYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGV
    N315            PYLRQMLGYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGV
    NCTC8325        PYLRQMLGYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGV
    Newman          PYLRQMLGYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGV
    USA300_FPR3757  PYLRQMLGYFIKYVGSSSYDAPAVLSMLFHMQQEQGLWYVEGGIHHLANALEKLAREEGV
                    ************************************************************

    COL             TIHTGARVDNIKTYQRRVTGVRLDTGEFVKADYIISNMEVIPTYKYLIHLDTQRLNKLER
    N315            TIHTGARVDNIKTYQRRVTGVRLDTGEFVKADYIISNMEVIPTYKYLIHLDTQRLNKLER
    NCTC8325        TIHTGARVDNIKTYQRRVTGVRLDTGEFVKADYIISNMEVIPTYKYLIHLDTQRLNKLER
    Newman          TIHTGARVDNIKTYQRRVTGVRLDTGEFVKADYIISNMEVIPTYKYLIHLDTQRLNKLER
    USA300_FPR3757  TIHTGARVDNIKTYQRRVTGVRLDTGEFVKADYIISNMEVIPTYKYLIHLDTQRLNKLER
                    ************************************************************

    COL             EFEPASSGYVMHLGVACQYPQLAHHNFFFTENAYLNYQQVFHEKVLPDDPTIYLVNTNKT
    N315            EFEPASSGYVMHLGVACQYPQLAHHNFFFTENAYLNYQQVFHEKVLPDDPTIYLVNTNKT
    NCTC8325        EFEPASSGYVMHLGVACQYPQLAHHNFFFTENAYLNYQQVFHEKVLPDDPTIYLVNTNKT
    Newman          EFEPASSGYVMHLGVACQYPQLAHHNFFFTENAYLNYQQVFHEKVLPDDPTIYLVNTNKT
    USA300_FPR3757  EFEPASSGYVMHLGVACQYPQLAHHNFFFTENAYLNYQQVFHEKVLPDDPTIYLVNTNKT
                    ************************************************************

    COL             DHTQAPVGYENIKVLPHIPYIQDQPFTTEDYAKFRDKILDKLEKMGLTDLRKHIIYEDVW
    N315            DHTQAPVGYENIKVLPHIPYIQDQPFTTEDYAKFRDKILDKLEKMGLTDLRKHIIYEDVW
    NCTC8325        DHTQAPVGYENIKVLPHIPYIQDQPFTTEDYAKFRDKILDKLEKMGLTDLRKHIIYEDVW
    Newman          DHTQAPVGYENIKVLPHIPYIQDQPFTTEDYAKFRDKILDKLEKMGLTDLRKHIIYEDVW
    USA300_FPR3757  DHTQAPVGYENIKVLPHIPYIQDQPFTTEDYAKFRDKILDKLEKMGLTDLRKHIIYEDVW
                    ************************************************************

    COL             TPEDIEKNYRSNRGAIYGVVADKKKNKGFKFPKESQYFENLYFVGGSVNPGGGMPMVTLS
    N315            TPEDIEKNYRSNRGAIYGVVADKKKNKGFKFPKESQYFENLYFVGGSVNPGGGMPMVTLS
    NCTC8325        TPEDIEKNYRSNRGAIYGVVADKKKNKGFKFPKESQYFENLYFVGGSVNPGGGMPMVTLS
    Newman          TPEDIEKNYRSNRGAIYGVVADKKKNKGFKFPKESQYFENLYFVGGSVNPGGGMPMVTLS
    USA300_FPR3757  TPEDIEKNYRSNRGAIYGVVADKKKNKGFKFPKESQYFENLYFVGGSVNPGGGMPMVTLS
                    ************************************************************

    COL             GQQVADKINAREAKNRK
    N315            GQQVADKINAREAKNRK
    NCTC8325        GQQVADKINAREAKNRK
    Newman          GQQVADKINAREAKNRK
    USA300_FPR3757  GQQVADKINAREAKNRK
                    *****************