From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006240000
  • symbol?:
  • description?: TetR family transcriptional regulator

      descriptions from strain specific annotations:

    • TetR family transcriptional regulator
    • Transcriptional regulator, TetR family
    • regulatory proteins, tetR family protein
    • bacterial regulatory s, tetR family protein
    • TetR family regulatory protein
    • transcriptional regulator, AcrR
    • regulatory protein TetR family
  • strand?: +
  • coordinates?: 6303292..6303894
  • synteny block?: BlockID0049640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2509
    08BA02176:
    C248_2630
    11819-97:
    MS7_2578
    71193:
    ST398NM01_2622
    ECT-R 2:
    ECTR2_2426
    ED133:
    SAOV_2616
    ED98:
    SAAV_2638
    HO 5096 0412:
    SAEMRSA15_24740
    JH1:
    SaurJH1_2648
    JH9:
    SaurJH9_2594
    JKD6008:
    SAA6008_02610 (acrA)
    JKD6159:
    SAA6159_02467 (acrA)
    LGA251:
    SARLGA251_23460
    M013:
    M013TW_2546
    MRSA252:
    SAR2652
    MSHR1132:
    SAMSHR1132_23870
    MSSA476:
    SAS2458
    Mu3:
    SAHV_2555
    Mu50:
    SAV2571
    MW2:
    MW2492
    RF122:
    SAB2445
    ST398:
    SAPIG2622
    T0131:
    SAT0131_02783 (icaB)
    TCH60:
    HMPREF0772_10619
    TW20:
    SATW20_26920
    USA300_TCH1516:
    USA300HOU_2566
    VC40:
    SAVC_11735

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKQQMLGSEQMMESKSIDPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRAT
    N315            -----------MMESKSIDPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRAT
    NCTC8325        -----------MMESKSIDPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRAT
    Newman          -----MLGSEQMMESKSIDPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRAT
    USA300_FPR3757  -----------MMESKSIDPRIVRTKQLLVDAFLKISREKKLSQITVKDITDIATLNRAT
                               *************************************************

    COL             FYAHFTDKEDLLDYTLSVTILKDLNDNLSISNVINEKVLRNIFISIASYIKDAAKSCELN
    N315            FYAHFTDKEDLLDYTLSVTILKDLNDNLSISNVINEKVLRNIFISIASYIKDAAKSCELN
    NCTC8325        FYAHFADKEDLLDYTLSVTILKDLNDNLSISNVINEKVLRNIFISIASYIKDAAKSCELN
    Newman          FYAHFTDKEDLLDYTLSVTILKDLNDNLSISNVINEKVLRNIFISIASYIKDAAKSCELN
    USA300_FPR3757  FYAHFTDKEDLLDYTLSVTILKDLNDNLSISNVINEKVLRNIFISIASYIKDAAKSCELN
                    *****:******************************************************

    COL             SEAFCNKAHQRINNELEDIFAIMLENSYPEHQRDIIVNSASFLAAGISGLALHWFNTSQE
    N315            SEAFCNKAHQRINNELEDIFAIMLENSYPEHQRDIIVNSASFLAAGISGLALHWFNTSQE
    NCTC8325        SEAFCNKAHQRINNELEDIFAIMLENSYPEHQRDIIVNSASFLAAGISGLALHWFNTSQE
    Newman          SEAFCNKAHQRINNELEDIFAIMLENSYPEHQRDIIVNSASFLAAGISGLALHWFNTSQE
    USA300_FPR3757  SEAFCNKAHQRINNELEDIFAIMLENSYPEHQRDIIVNSASFLAAGISGLALHWFNTSQE
                    ************************************************************

    COL             TADVFIDRNLPFLIHHIAHF
    N315            TADVFIDRNLPFLIHHIAHF
    NCTC8325        TADVFIDRNLPFLIHHIAHF
    Newman          TADVFIDRNLPFLIHHIAHF
    USA300_FPR3757  TADVFIDRNLPFLIHHIAHF
                    ********************