From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006253000
  • symbol?:
  • description?: short chain oxidoreductase

      descriptions from strain specific annotations:

    • short chain oxidoreductase
    • short chain dehydrogenase/reductase family oxidoreductase
    • short chain dehydrogenase family protein
    • short-chain dehydrogenase/reductase SDR
    • Short chain dehydrogenase
    • short chain dehydrogenase/reductase oxidoreductase
    • putative short chain dehydrogenase
  • strand?: +
  • coordinates?: 6309998..6310717
  • synteny block?: BlockID0049760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2517
    08BA02176:
    C248_2637
    11819-97:
    MS7_2585
    71193:
    ST398NM01_2629
    ECT-R 2:
    ECTR2_2433
    ED133:
    SAOV_2623
    ED98:
    SAAV_2645
    HO 5096 0412:
    SAEMRSA15_24810
    JH1:
    SaurJH1_2655
    JH9:
    SaurJH9_2601
    JKD6008:
    SAA6008_02617
    JKD6159:
    SAA6159_02476
    LGA251:
    SARLGA251_23530
    M013:
    M013TW_2553
    MRSA252:
    SAR2659
    MSHR1132:
    SAMSHR1132_23940
    MSSA476:
    SAS2465
    Mu3:
    SAHV_2563
    Mu50:
    SAV2579
    MW2:
    MW2499
    RF122:
    SAB2453
    ST398:
    SAPIG2629
    T0131:
    SAT0131_02790
    TCH60:
    HMPREF0772_10612
    TW20:
    SATW20_26990
    USA300_TCH1516:
    USA300HOU_2573
    VC40:
    SAVC_11770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKIVLITGGNKGLGYASAEALKALGYKVYIGSRNDVRGQQASQKLGVHYVQLDVTSDYS
    N315            MTKIVLITGGNKGLGYASAEALKALGYKVYIGSRNDVRGQQASQKLGVHYVQLDVTSDYS
    NCTC8325        MTKIVLITGGNKGLGYASAEALKALGYKVYIGSRNDVRGQQASQKLGVHYVQLDVTSDYS
    Newman          MTKIVLITGGNKGLGYASAEALKALGYKVYIGSRNDVRGQQASQKLGVHYVQLDVTSDYS
    USA300_FPR3757  MTKIVLITGGNKGLGYASAEALKALGYKVYIGSRNDVRGQQASQKLGVHYVQLDVTSDYS
                    ************************************************************

    COL             VKNAYNMIAEKEGRLDILINNAGISGQFSAPSKLTPRDVEEVYQTNVFGIVRMMNTFVPL
    N315            VKNAYNMIAEKEGRLDILINNAGISGQFSAPSKLTPRDVEEVYQTNVFGIVRMMNTFVPL
    NCTC8325        VKNAYNMIAEKEGRLDILINNAGISGQFSAPSKLTPRDVEEVYQTNVFGIVRMMNTFVPL
    Newman          VKNAYNMIAEKEGRLDILINNAGISGQFSAPSKLTPRDVEEVYQTNVFGIVRMMNTFVPL
    USA300_FPR3757  VKNAYNMIAEKEGRLDILINNAGISGQFSAPSKLTPRDVEEVYQTNVFGIVRMMNTFVPL
                    ************************************************************

    COL             LEKSEQPVVVNVSSGLGSFGMVTNPETAESKVNSLAYCSSKSAVTMLTLQYAKGLPNMQI
    N315            LEKSEQPVVVNVSSGLGSFGMVTNPETAESKVNSLAYCSSKSAVTMLTLQYAKGLPNMQI
    NCTC8325        LEKSEQPVVVNVSSGLGSFGMVTNPETAESKVNSLAYCSSKSAVTMLTLQYAKGLPNMQI
    Newman          LEKSEQPVVVNVSSGLGSFGMVTNPETAESKVNSLAYCSSKSAVTMLTLQYAKGLPNMQI
    USA300_FPR3757  LEKSEQPVVVNVSSGLGSFGMVTNPETAESKVNSLAYCSSKSAVTMLTLQYAKGLPNMQI
                    ************************************************************

    COL             NAADPGATNTDLVGDFSNNSKHVSEGIKPIIQLATIGADGPTGTFINGDGEMPW
    N315            NAADPGATNTDLVGDFSNNSKHVSEGIKPIIQLATIGADGPTGTFINGDGEMPW
    NCTC8325        NAADPGATNTDLVGDFSNNSKHVSEGIKPIIQLATIGADGPTGTFINGDGEMPW
    Newman          NAADPGATNTDLVGDFSNNSKHVSEGIKPIIQLATIGADGPTGTFINGDGEMPW
    USA300_FPR3757  NAADPGATNTDLVGDFSNNSKHVSEGIKPIIQLATIGADGPTGTFINGDGEMPW
                    ******************************************************