From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006259000
  • symbol?:
  • description?: cobalamin synthesis-like protein CobW

      descriptions from strain specific annotations:

    • cobalamin synthesis-like protein CobW
    • cobalamin synthesis protein, P47K
    • cobalamin synthesis protein P47K
    • cobalamin synthesis protein, putative
    • Putative GTPases (G3E family)
    • cobW/HypB/UreG, nucleotide-binding domain protein
    • putative cobalamin synthesis protein
    • cobalamin (vitamin B12) biosynthesis protein
    • cobalamin synthesis protein/P47K family protein
    • cobalmin synthesis protein
    • Low-affinity zinc transport protein
    • putative metal chaperone, GTPase
    • cobalamin synthesis related protein, CobW
  • strand?: -
  • coordinates?: 6314221..6315111
  • synteny block?: BlockID0049820
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2520 (cobW)
    08BA02176:
    C248_2641
    11819-97:
    MS7_2588
    71193:
    ST398NM01_2632
    ECT-R 2:
    ECTR2_2436
    ED133:
    SAOV_2627c
    ED98:
    SAAV_2648
    HO 5096 0412:
    SAEMRSA15_24850
    JH1:
    SaurJH1_2658
    JH9:
    SaurJH9_2604
    JKD6008:
    SAA6008_02620
    JKD6159:
    SAA6159_02479
    LGA251:
    SARLGA251_23560
    M013:
    M013TW_2556
    MRSA252:
    SAR2662
    MSHR1132:
    SAMSHR1132_23970
    MSSA476:
    SAS2468
    Mu3:
    SAHV_2566
    Mu50:
    SAV2582
    MW2:
    MW2502
    RF122:
    SAB2456c
    ST398:
    SAPIG2632
    T0131:
    SAT0131_02794
    TCH60:
    HMPREF0772_10609
    TW20:
    SATW20_27030
    USA300_TCH1516:
    USA300HOU_2576 (cobW3)
    VC40:
    SAVC_11785

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIVIIGGFLGGGKTTVLNHLLAESLKESLKPAVIMNEFGKMSVDGALVSEDIPLSELTE
    N315            MKIVIIGGFLGGGKTTVLNHLLAESLKESLKPAVIMNEFGKMSVDGALVSEDIPLSELTE
    NCTC8325        MKIVIIGGFLGGGKTTVLNHLLAESLKESLKPAVIMNEFGKMSVDGALVSEDIPLSELTE
    Newman          MKIVIIGGFLGGGKTTVLNHLLAESLKESLKPAVIMNEFGKMSVDGALVSEDIPLSELTE
    USA300_FPR3757  MKIVIIGGFLGGGKTTVLNHLLAESLKESLKPAVIMNEFGKMSVDGALVSEDIPLSELTE
                    ************************************************************

    COL             GCICCAMKADVSEQLHQLYLKEQPDIVFIECSGIAEPVSVLDACLTPILAPFTTITHMIG
    N315            GCICCAMKADVSEQLHQLYLKEQPDIVFIECSGIAEPVSVLDACLTPILAPFTTITHMIG
    NCTC8325        GCICCAMKADVSEQLHQLYLKEQPDIVFIECSGIAEPVSVLDACLTPILAPFTTITHMIG
    Newman          GCICCAMKADVSEQLHQLYLKEQPDIVFIECSGIAEPVSVLDACLTPILAPFTTITHMIG
    USA300_FPR3757  GCICCAMKADVSEQLHQLYLKEQPDIVFIECSGIAEPVSVLDACLTPILAPFTTITHMIG
                    ************************************************************

    COL             VIDASMYKHIKSFPKDIQGLFYEQLAYCSVLFVNKIDSADVETTSKLLKDLEVINPEADI
    N315            VIDASMYKHIKSFPKDIQGLFYEQLAYCSVLFVNKIDSADVETTSKLLKDLEVINPEADI
    NCTC8325        VIDASMYKHIKSFPKDIQGLFYEQLAYCSVLFVNKIDSADVETTSKLLKDLEVINPEADI
    Newman          VIDASMYKHIKSFPKDIQGLFYEQLAYCSVLFVNKIDSADVETTSKLLKDLEVINPEADI
    USA300_FPR3757  VIDASMYKHIKSFPKDIQGLFYEQLAYCSVLFVNKIDSADVETTSKLLKDLEVINPEADI
                    ************************************************************

    COL             QVGMHGSVTLPISVRQMTATSDNKHKSLHQMINHQFVQSPVKCTKAEFIKRLACLPSHIY
    N315            QVGMHGSVTLPISVRQMTATSDNKHESLHKTINHQFVQSPVTCTKAEFIKRLACLPSHIY
    NCTC8325        QVGMHGSVTLPISVRQMTATSDNKHKSLHQMINHQFVQSPVKCTKAEFIKRLACLPSHIY
    Newman          QVGMHGSVTLPISVRQMTATSDNKHKSLHQMINHQFVQSPVKCTKAEFIKRLACLPSHIY
    USA300_FPR3757  QVGMHGSVTLPISVRQMTATSDNKHKSLHQMINHQFVQSPVKCTKAEFIKRLACLPSHIY
                    *************************:***: **********.******************

    COL             RLKGFMTFEDTAHTYLIQFTQGQYELTPVAFSKKVPEYLVLIGKGISKEDYQCLEQ
    N315            RLKGFMTFEDTTHTYLIQFTQGQYELTPVAFSKKVPEYLVLIGKGISKEDYQCLEQ
    NCTC8325        RLKGFMTFEDTAHTYLIQFTQGQYELTPVAFSKKVPEYLVLIGKGISKEDYQCLEQ
    Newman          RLKGFMTFEDTAHTYLIQFTQGQYELTPVAFSKKVPEYLVLIGKGISKEDYQCLEQ
    USA300_FPR3757  RLKGFMTFEDTAHTYLIQFTQGQYELTPVAFSKKVPEYLVLIGKGISKEDYQCLEQ
                    ***********:********************************************