From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2519 [new locus tag: SAUSA300_RS13980 ]
  • pan locus tag?: SAUPAN006259000
  • symbol: SAUSA300_2519
  • pan gene symbol?:
  • synonym:
  • product: putative cobalamin synthesis protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_2519 [new locus tag: SAUSA300_RS13980 ]
  • symbol: SAUSA300_2519
  • product: putative cobalamin synthesis protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2721720..2722610
  • length: 891
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAAATAGTTATTATAGGTGGGTTTTTAGGTGGCGGTAAAACGACTGTCTTAAATCAT
    TTGCTCGCTGAATCATTAAAGGAATCGCTGAAACCAGCAGTCATCATGAATGAATTTGGG
    AAAATGAGTGTTGATGGTGCCTTAGTATCTGAAGACATACCTTTAAGTGAACTGACAGAG
    GGGTGTATCTGTTGTGCAATGAAAGCAGATGTATCAGAACAGTTACATCAATTATATTTA
    AAAGAGCAACCAGACATTGTATTTATTGAATGTAGTGGGATTGCAGAACCGGTCTCTGTC
    TTAGATGCTTGTTTAACGCCTATTTTAGCTCCGTTTACAACAATTACACATATGATTGGT
    GTAATAGACGCAAGCATGTATAAACACATTAAATCATTCCCTAAAGACATCCAAGGCTTA
    TTTTATGAGCAATTAGCATATTGTTCTGTCTTATTTGTTAATAAAATAGATTCAGCAGAT
    GTTGAAACAACGAGCAAACTATTGAAAGATTTAGAAGTTATTAACCCAGAGGCCGATATA
    CAAGTCGGTATGCATGGCAGCGTCACTTTGCCAATATCAGTTAGACAAATGACAGCAACT
    TCTGACAATAAACATAAGTCTTTACATCAAATGATTAATCATCAATTTGTGCAATCACCA
    GTCAAATGTACTAAAGCAGAGTTTATAAAACGTTTAGCATGCCTTCCGTCTCATATTTAT
    AGGTTGAAAGGGTTTATGACATTTGAAGACACCGCACATACGTATCTCATTCAATTTACA
    CAAGGACAATATGAATTAACACCTGTAGCATTTTCAAAAAAAGTGCCAGAATATTTGGTG
    CTTATCGGAAAGGGTATTTCAAAAGAAGACTATCAATGTTTGGAACAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    891

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_2519 [new locus tag: SAUSA300_RS13980 ]
  • symbol: SAUSA300_2519
  • description: putative cobalamin synthesis protein
  • length: 296
  • theoretical pI: 5.98589
  • theoretical MW: 32835.1
  • GRAVY: 0.117568

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 83.2)
    Genetic information processingProtein fateProtein modification and repairhydrogenase accessory protein HypB (TIGR00073; HMM-score: 24.8)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 17.4)
  • TheSEED:  
    Putative metal chaperone, involved in Zn homeostasis, GTPase of COG0523 family 
  • PFAM:
    P-loop_NTPase (CL0023) cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 155.4)
    no clan definedCobW_C; Cobalamin synthesis protein cobW C-terminal domain (PF07683; HMM-score: 36.9)
    P-loop_NTPase (CL0023) Arf; ADP-ribosylation factor family (PF00025; HMM-score: 21.8)
    AAA_28; AAA domain (PF13521; HMM-score: 14.7)
    AAA_18; AAA domain (PF13238; HMM-score: 12.3)
    AAA_22; AAA domain (PF13401; HMM-score: 12.1)
    Ras; Ras family (PF00071; HMM-score: 11.9)
    ArgK; ArgK protein (PF03308; HMM-score: 11.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.173
    • Ymax_pos: 24
    • Cmax: 0.145
    • Cmax_pos: 24
    • Smax: 0.32
    • Smax_pos: 1
    • Smean: 0.231
    • D: 0.195
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIVIIGGFLGGGKTTVLNHLLAESLKESLKPAVIMNEFGKMSVDGALVSEDIPLSELTEGCICCAMKADVSEQLHQLYLKEQPDIVFIECSGIAEPVSVLDACLTPILAPFTTITHMIGVIDASMYKHIKSFPKDIQGLFYEQLAYCSVLFVNKIDSADVETTSKLLKDLEVINPEADIQVGMHGSVTLPISVRQMTATSDNKHKSLHQMINHQFVQSPVKCTKAEFIKRLACLPSHIYRLKGFMTFEDTAHTYLIQFTQGQYELTPVAFSKKVPEYLVLIGKGISKEDYQCLEQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: Fur (Zur*)
    Fur  (Zur*) (TF) important in Zinc homeostasis  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]