From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006268000
  • symbol?:
  • description?: Fructosamine-3-kinase

      descriptions from strain specific annotations:

    • Fructosamine-3-kinase
    • phosphotransferase enzyme family protein
    • fructosamine kinase family protein
  • strand?: -
  • coordinates?: 6319510..6320319
  • synteny block?: BlockID0049910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2526
    08BA02176:
    C248_2649
    11819-97:
    MS7_2594
    71193:
    ST398NM01_2638
    ECT-R 2:
    ECTR2_2442
    ED133:
    SAOV_2633c
    ED98:
    SAAV_2654
    HO 5096 0412:
    SAEMRSA15_24910
    JH1:
    SaurJH1_2664
    JH9:
    SaurJH9_2610
    JKD6008:
    SAA6008_02647
    JKD6159:
    SAA6159_02485
    LGA251:
    SARLGA251_23620
    M013:
    M013TW_2562
    MRSA252:
    SAR2668
    MSHR1132:
    SAMSHR1132_24030
    MSSA476:
    SAS2474
    Mu3:
    SAHV_2572
    Mu50:
    SAV2588
    MW2:
    MW2508
    RF122:
    SAB2463c
    ST398:
    SAPIG2638
    T0131:
    SAT0131_02822 (tkt)
    TCH60:
    HMPREF0772_10603
    TW20:
    SATW20_27290
    USA300_TCH1516:
    USA300HOU_2582
    VC40:
    SAVC_11820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------------MSGGDVNEAYRVETDTDTFFLLVQRGRKESFYAAEIAGLNE
    N315            MNEQWLEHLPLKDIKEISPVSGGDVNEAYRVETDTDTFFLLVQRGRKESFYAAEIAGLNE
    NCTC8325        MNEQWLEHLPLKDIKEISPVSGGDVNEAYRVETDTDTFFLLVQRGRKESFYAAEIAGLNE
    Newman          MNEQWLEHLPLKDIKEISPVSGGDVNEAYRVETDTDTFFLLVQRGRKESFYAAEIAGLNE
    USA300_FPR3757  MNEQWLEHLPLKDIKEISPVSGGDVNEAYRVETDTDTFFLLVQRGRKESFYAAEIAGLNE
                                       :****************************************

    COL             FERAGITAPRVIASGEVNGDAYLVMTYLEEGASGSQRQLGQLVAQLHSQQQEEGKFGFSL
    N315            FERAGITAPRVIASGEVNGDVYLVMTYLEEGASGSQRQLGQLVAQLHSQQQEEGKFGFSL
    NCTC8325        FERAGITAPRVIASGEVNGDAYLVMTYLEEGASGSQRQLGQLVAQLHSQQQEEGKFGFSL
    Newman          FERAGITAPRVIASGEVNGDAYLVMTYLEEGASGSQRQLGQLVAQLHSQQQEEGKFGFSL
    USA300_FPR3757  FERAGITAPRVIASGEVNGDAYLVMTYLEEGASGSQRQLGQLVAQLHSQQQEEGKFGFSL
                    ********************.***************************************

    COL             PYEGGDISFDNHWQDDWCTIFVDKRLDHLKDELLNRGLWDANDIKVYDKVRRQIVAELEK
    N315            PYEGGDISFDNHWQDDWRTIFVDKRLDHLKEELLNRGLWDANDIKVYDKVRSQIVEELEK
    NCTC8325        PYEGGDISFDNHWQDDWCTIFVDKRLDHLKDELLNRGLWDANDIKVYDKVRRQIVAELEK
    Newman          PYEGGDISFDNHWQDDWCTIFVDKRLDHLKDELLNRGLWDANDIKVYDKVRRQIVAELEK
    USA300_FPR3757  PYEGGDISFDNHWQDDWCTIFVDKRLDHLKDELLNRGLWDANDIKVYDKVRRQIVAELEK
                    ***************** ************:******************** *** ****

    COL             HQSKPSLLHGDLWGGNYMFLQDGRPALFDPAPLYGDREFDIGITTVFGGFTSEFYDAYNK
    N315            HQSKPSLLHGDLWGGNYMFLKDGRPALFDPAPLYGDREFDIGITTVFGGFTSEFYDAYNK
    NCTC8325        HQSKPSLLHGDLWGGNYMFLQDGRPALFDPAPLYGDREFDIGITTVFGGFTSEFYDAYNK
    Newman          HQSKPSLLHGDLWGGNYMFLQDGRPALFDPAPLYGDREFDIGITTVFGGFTSEFYDAYNK
    USA300_FPR3757  HQSKPSLLHGDLWGGNYMFLQDGRPALFDPAPLYGDREFDIGITTVFGGFTSEFYDAYNK
                    ********************:***************************************

    COL             HYPLAKGASYRLEFYRLYLLMVHLLKFGEMYRDSVAHSMDKILQDTTS
    N315            HYPLAKGASYRLEFYRLYLLMVHLLKFGEMYRDSVAHSMDRILQGTTS
    NCTC8325        HYPLAKGASYRLEFYRLYLLMVHLLKFGEMYRDSVAHSMDKILQDTTS
    Newman          HYPLAKGASYRLEFYRLYLLMVHLLKFGEMYRDSVAHSMDKILQDTTS
    USA300_FPR3757  HYPLAKGASYRLEFYRLYLLMVHLLKFGEMYRDSVAHSMDKILQDTTS
                    ****************************************:***.***