From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006300000
  • symbol?:
  • description?: amino acid permease

      descriptions from strain specific annotations:

    • amino acid permease
    • amino acid permease family protein
    • amino acid transporter
    • APC family amino acid-polyamine-organocation transporter
    • cationic amino acid transporter
  • strand?: +
  • coordinates?: 6346617..6348080
  • synteny block?: BlockID0050160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2541
    08BA02176:
    C248_2662
    11819-97:
    MS7_2608
    71193:
    ST398NM01_2651
    ECT-R 2:
    ECTR2_2457
    ED133:
    SAOV_2647
    ED98:
    SAAV_2669
    HO 5096 0412:
    SAEMRSA15_25070
    JH1:
    SaurJH1_2679
    JH9:
    SaurJH9_2625
    JKD6008:
    SAA6008_02660
    JKD6159:
    SAA6159_02499
    LGA251:
    SARLGA251_23760
    M013:
    M013TW_2581
    MRSA252:
    SAR2681
    MSHR1132:
    SAMSHR1132_24180
    MSSA476:
    SAS2488
    Mu3:
    SAHV_2587
    Mu50:
    SAV2603
    MW2:
    MW2522
    RF122:
    SAB2476
    ST398:
    SAPIG2651
    T0131:
    SAT0131_02835
    TCH60:
    HMPREF0772_10589
    TW20:
    SATW20_27420
    USA300_TCH1516:
    USA300HOU_2595
    VC40:
    SAVC_11885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGSFFNKIARKEDPAIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGIVAAEHAGP
    N315            MGSFFNKIARKEDPAIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGIVAAEHAGP
    NCTC8325        MGSFFNKIARKEDPAIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGIVAAEHAGP
    Newman          MGSFFNKIARKEDPAIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGIVAAEHAGP
    USA300_FPR3757  MGSFFNKIARKEDPAIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGIVAAEHAGP
                    ************************************************************

    COL             AVALSFLLAAIVAGLVAFTYAEMAAAMPFAGSAYSWVNVLFGEFFGWVAGWALLAEYFIA
    N315            AVALSFLLAAIVAGLVAFTYAEMAAAMPFAGSAYSWVNVLFGEFFGWVAGWALLAEYFIA
    NCTC8325        AVALSFLLAAIVAGLVAFTYAEMAAAMPFAGSAYSWVNVLFGEFFGWVAGWALLAEYFIA
    Newman          AVALSFLLAAIVAGLVAFTYAEMAAAMPFAGSAYSWVNVLFGEFFGWVAGWALLAEYFIA
    USA300_FPR3757  AVALSFLLAAIVAGLVAFTYAEMAAAMPFAGSAYSWVNVLFGEFFGWVAGWALLAEYFIA
                    ************************************************************

    COL             VAFVASGFSANLRGLVKPIGIELPAALSNPFGTNGGFIDIIAAIVILLTALLLSRGMSEA
    N315            VAFVASGFSANLRGLVKPIGIELPAALSNPFGTNGGFIDIIAAIVILLTALLLSRGMSEA
    NCTC8325        VAFVASGFSANLRGLVKPIGIELPAALSNPFGTNGGFIDIIAAIVILLTALLLSRGMSEA
    Newman          VAFVASGFSANLRGLVKPIGIELPAALSNPFGTNGGFIDIIAAIVILLTALLLSRGMSEA
    USA300_FPR3757  VAFVASGFSANLRGLVKPIGIELPAALSNPFGTNGGFIDIIAAIVILLTALLLSRGMSEA
                    ************************************************************

    COL             ARMENILVILKVLAIILFVIVGLTAINVSNYVPFIPEHKVTATGDFGGWQGIYAGVSMIF
    N315            ARMENILVILKVLAIILFVIVGLTAINVSNYVPFIPEHKVTATGDFGGWQGIYAGVSMIF
    NCTC8325        ARMENILVILKVLAIILFVIVGLTAINVSNYVPFIPEHKVTATGDFGGWQGIYAGVSMIF
    Newman          ARMENILVILKVLAIILFVIVGLTAINVSNYVPFIPEHKVTATGDFGGWQGIYAGVSMIF
    USA300_FPR3757  ARMENILVILKVLAIILFVIVGLTAINVSNYVPFIPEHKVTATGDFGGWQGIYAGVSMIF
                    ************************************************************

    COL             LAYIGFDSIAANSAEALDPQKTMPRGILGSLSVAIVLFIAVALVLVGMFHYSQYANNAEP
    N315            LAYIGFDSIAANSAEALDPQKTMPRGILGSLSVAIVLFIAVALVLVGMFHYSQYANNAEP
    NCTC8325        LAYIGFDSIAANSAEALDPQKTMPRGILGSLSVAIVLFIAVALVLVGMFHYSQYANNAEP
    Newman          LAYIGFDSIAANSAEALDPQKTMPRGILGSLSVAIVLFIAVALVLVGMFHYSQYANNAEP
    USA300_FPR3757  LAYIGFDSIAANSAEALDPQKTMPRGILGSLSVAIVLFIAVALVLVGMFHYSQYANNAEP
                    ************************************************************

    COL             VGWALRQSGHGVVAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLSHLNDKH
    N315            VGWALRQSGHGVVAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLSHLNDKH
    NCTC8325        VGWALRQSGHGVVAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWVSHLNDKH
    Newman          VGWALRQSGHGVVAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLSHLNDKH
    USA300_FPR3757  VGWALRQSGHGVVAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLSHLNDKH
                    ****************************************************:*******

    COL             LPNRALVILTIIGVLIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDLPIPAF
    N315            LPNRALVILTIIGVLIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDLPIPAF
    NCTC8325        LPNRALVILTIIGVLIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDLPIPAF
    Newman          LPNRALVILTIIGVLIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDLPIPAF
    USA300_FPR3757  LPNRALVILTIIGVLIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDLPIPAF
                    ************************************************************

    COL             KLPLYPVLPAITFVLVLLVFWGLGFEAKLYTLIWFIVGIILYLSYGLRHSKKNDVAEYHP
    N315            KLPLYPVLPAITFVLVLLVFWGLGFEAKLYTLIWFIVGIILYLSYGLRHSKKNDVAEYHP
    NCTC8325        KLPLYPVLPAITFVLVLLVFWGLGFEAKLYTLIWFIVGIILYLSYGLRHSKKNDVAEYHP
    Newman          KLPLYPVLPAITFVLVLLVFWGLGFEAKLYTLIWFIVGIILYLSYGLRHSKKNDVAEYHP
    USA300_FPR3757  KLPLYPVLPAITFVLVLLVFWGLGFEAKLYTLIWFIVGIILYLSYGLRHSKKNDVAEYHP
                    ************************************************************

    COL             PK
    N315            PK
    NCTC8325        PK
    Newman          PK
    USA300_FPR3757  PK
                    **