From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan006321000
  • symbol?: nrdG
  • description?: anaerobic (class III) ribonucleotide reductase small subunit chain

      descriptions from strain specific annotations:

    • anaerobic (class III) ribonucleotide reductase small subunit chain
    • anaerobic ribonucleoside-triphosphate reductase activating protein
    • Ribonucleotide reductase of class III (anaerobic), activating protein
    • anaerobic ribonucleotide reductase, small subunit
    • anaerobic ribonucleotide reductase small subunit
    • anaerobic ribonucleotide reductase activating protein
    • putative anaerobic ribonucleotide reductase activating protein
    • pyruvate formate-lyase activating enzyme
  • strand?: -
  • coordinates?: 6364458..6364994
  • synteny block?: BlockID0050370
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2634 (nrdG)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2554
    08BA02176:
    C248_2678 (nrdG)
    11819-97:
    MS7_2621 (nrdG)
    71193:
    ST398NM01_2663
    ECT-R 2:
    ECTR2_2470 (nrdG)
    ED133:
    SAOV_2662c
    ED98:
    SAAV_2682 (nrdG)
    HO 5096 0412:
    SAEMRSA15_25200 (nrdG)
    JH1:
    SaurJH1_2693
    JH9:
    SaurJH9_2639
    JKD6008:
    SAA6008_02673 (nrdG)
    JKD6159:
    SAA6159_02512 (nrdG)
    LGA251:
    SARLGA251_23880 (nrdG)
    M013:
    M013TW_2594
    MRSA252:
    SAR2694 (nrdG)
    MSHR1132:
    SAMSHR1132_24320
    MSSA476:
    SAS2502
    Mu3:
    SAHV_2600
    Mu50:
    SAV2616
    MW2:
    MW2536
    RF122:
    SAB2490c (nrdG)
    ST398:
    SAPIG2663 (nrdG)
    T0131:
    SAT0131_02849 (fmtC)
    TCH60:
    HMPREF0772_10574 (nrdG)
    TW20:
    SATW20_27540 (nrdG)
    USA300_TCH1516:
    USA300HOU_2613 (nrdG)
    VC40:
    SAVC_11945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILLDIKQGQGYIAKIESNSFVDGEGVRCSVYVSGCPFNCVGCYNKASQKFRYGEKYTDE
    N315            MTLLDIKQGQGYIAKIESNSFVDGEGVRCSVYVSGCPFNCVGCYNKASQKFRYGEKYTDE
    NCTC8325        MILLDIKQGQGYIAKIESNSFVDGEGVRCSVYVSGCPFNCVGCYNKASQKFRYGEKYTDE
    Newman          MILLDIKQGQGYIAKIESNSFVDGEGVRCSVYVSGCPFNCVGCYNKASQKFRYGEKYTDE
    USA300_FPR3757  MILLDIKQGQGYIAKIESNSFVDGEGVRCSVYVSGCPFNCVGCYNKASQKFRYGEKYTDE
                    * **********************************************************

    COL             ILAEILDDCDHDYISGLSLLGGEPFCNLDITLNLVKAFRARFGNTKTIWVWTGFLYEYLA
    N315            ILAEILDDCDHDYISGLSLLGGEPFCNLDITLNLVKAFRARFGNTKTIWVWTGFLYEYLA
    NCTC8325        ILAEILDDCDHDYISGLSLLGGEPFCNLDITLNLVKAFRARFGNTKTIWVWTGFLYEYLA
    Newman          ILAEILDDCDHDYISGLSLLGGEPFCNLDITLNLVKAFRARFGNTKTIWVWTGFLYEYLA
    USA300_FPR3757  ILAEILDDCDHDYISGLSLLGGEPFCNLDITLNLVKAFRARFGNTKTIWVWTGFLYEYLA
                    ************************************************************

    COL             NDCTERRELLSYIDVLVDGLFIQHLFKPDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
    N315            NDCTERRELLSYIDVLVDGLFIQHLFKPDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
    NCTC8325        NDCTERRELLSYIDVLVDGLFIQHLFKPDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
    Newman          NDCTERRELLSYIDVLVDGLFIQHLFKPDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
    USA300_FPR3757  NDCTERRELLSYIDVLVDGLFIQHLFKPDLPYKGSLNQRIIDVQQSLSHARMIEYIVS
                    **********************************************************