From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006329000
  • symbol?: gpxA2
  • description?: glutathione peroxidase

      descriptions from strain specific annotations:

    • glutathione peroxidase
    • peroxiredoxin
    • glutathione peroxidase family protein
    • peroxiredoxin HYR1
    • putative glutathione peroxidase
    • peroxiredoxin Hyr1 (hydrogen peroxide resistanceprotein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase 3)(phospholipid hydroperoxide glutathione peroxidase 3) (phgpx3)
  • strand?: -
  • coordinates?: 6372477..6372974
  • synteny block?: BlockID0050450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2641 (gpxA2)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2559
    08BA02176:
    C248_2685
    11819-97:
    MS7_2626 (gpx2)
    71193:
    ST398NM01_2669
    ECT-R 2:
    ECTR2_2475
    ED133:
    SAOV_2667c
    ED98:
    SAAV_2688 (gpxA2)
    HO 5096 0412:
    SAEMRSA15_25250
    JH1:
    SaurJH1_2699
    JH9:
    SaurJH9_2644
    JKD6008:
    SAA6008_02679 (gpxA2)
    JKD6159:
    SAA6159_02517 (gpxA2)
    LGA251:
    SARLGA251_23930
    M013:
    M013TW_2599
    MRSA252:
    SAR2699
    MSHR1132:
    SAMSHR1132_24370
    MSSA476:
    SAS2507
    Mu3:
    SAHV_2605
    Mu50:
    SAV2621
    MW2:
    MW2541
    RF122:
    SAB2495c
    ST398:
    SAPIG2669
    T0131:
    SAT0131_02856
    TCH60:
    HMPREF0772_10569 (gpo)
    TW20:
    SATW20_27590
    USA300_TCH1516:
    USA300HOU_2619 (gpxA2)
    VC40:
    SAVC_11970

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
    N315            MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
    NCTC8325        MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
    Newman          MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
    USA300_FPR3757  MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
                    ************************************************************

    COL             VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
    N315            VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
    NCTC8325        VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
    Newman          VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
    USA300_FPR3757  VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
                    ************************************************************

    COL             GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
    N315            GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
    NCTC8325        GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
    Newman          GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
    USA300_FPR3757  GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILLQESSS
                    *********************************************