From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006334000
  • symbol?:
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • ABC transporter ATP-binding protein
    • permease family protein
    • ABC transporter permease protein
    • ftsX-like permease family protein
    • ABC transporter protein
    • permease domain-containing protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
  • strand?: -
  • coordinates?: 6374523..6377423
  • synteny block?: BlockID0050500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2561
    08BA02176:
    C248_2689
    11819-97:
    MS7_2627
    71193:
    ST398NM01_2671
    ECT-R 2:
    ECTR2_2476
    ED133:
    SAOV_2670c
    ED98:
    SAAV_2690
    HO 5096 0412:
    SAEMRSA15_25260
    JH1:
    SaurJH1_2701
    JH9:
    SaurJH9_2645
    JKD6008:
    SAA6008_02681
    JKD6159:
    SAA6159_02518
    LGA251:
    SARLGA251_23940
    M013:
    M013TW_2601
    MRSA252:
    SAR2700
    MSHR1132:
    SAMSHR1132_24380
    MSSA476:
    SAS2508
    Mu3:
    SAHV_2606
    Mu50:
    SAV2622
    MW2:
    MW2542
    RF122:
    SAB2497c
    ST398:
    SAPIG2671
    T0131:
    SAT0131_02885
    TCH60:
    HMPREF0772_10567
    TW20:
    SATW20_27600
    USA300_TCH1516:
    USA300HOU_2621
    VC40:
    SAVC_11980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKLRLLWHIVRRQFITQRLVIIPFILAVSVLFMIEYTLVSIGLNSYIKQKNDFLVPFIII
    N315            MKLRLLWHIVRRQFITQRLVIIPFILAVSVLFMIEYTLVSIGLNSYIKQKNDFLVPFIII
    NCTC8325        MKLRLLWHIVRRQFITQRLVIIPFILAVSVLFMIEYTLVSIGLNSYIKQKNDFLVPFIII
    Newman          MKLRLLWHIVRRQFITQRLVIIPFILAVSVLFMIEYTLVSIGLNSYIKQKNDFLVPFIII
    USA300_FPR3757  MKLRLLWHIVRRQFITQRLVIIPFILAVSVLFMIEYTLVSIGLNSYIKQKNDFLVPFIII
                    ************************************************************

    COL             ANFFMALLTFIFIFYANHFMMSQRRKEFSIFMTLGMTKKSMRLIVVMETILQFVIISVVS
    N315            ANFFMALLTFIFIFYANHFMMSQRRKEFSIFMTLGMTKKSMRLIVVMETILQFVIISVVS
    NCTC8325        ANFFMALLTFIFIFYANHFMMSQRRKEFSIFMTLGMTKKSMRLIVVMETILQFVIISVVS
    Newman          ANFFMALLTFIFIFYANHFMMSQRRKEFSIFMTLGMTKKSMRLIVVMETILQFVIISVVS
    USA300_FPR3757  ANFFMALLTFIFIFYANHFMMSQRRKEFSIFMTLGMTKKSMRLIVVMETILQFVIISVVS
                    ************************************************************

    COL             IAGGYLLGAIFFLFIQKIMGSEVATLRYYPFDSVAMFITLIIIAVLMGMLLIFNLFSINF
    N315            IAGGYLLGAIFFLFIQKIMGSEVATLRYYPFDSVAMFITLIIIAVLMGMLLIFNLFSINF
    NCTC8325        IAGGYLLGAIFFLFIQKIMGSEVATLRYYPFDSVAMFITLIIIAVLMGMLLIFNLFSINF
    Newman          IAGGYLLGAIFFLFIQKIMGSEVATLRYYPFDSVAMFITLIIIAVLMGMLLIFNLFSINF
    USA300_FPR3757  IAGGYLLGAIFFLFIQKIMGSEVATLRYYPFDSVAMFITLIIIAVLMGMLLIFNLFSINF
                    ************************************************************

    COL             QRPITYQHRSDSSVISRWLRYVLIVIGSAALYLGYFIALQQDTTFGAFFKIWIVIGLVII
    N315            QRPITYQHRSDSSVISRWLRYVLIVIGSAALYLGYFIALQQDTTFGAFFKIWIVIGLVII
    NCTC8325        QRPITYQHRSDSSVISRWLRYVLIVIGSAALYLGYFIALQQDTTFGAFFKIWIVIGLVII
    Newman          QRPITYQHRSDSSVISRWLRYVLIVIGSAALYLGYFIALQQDTTFGAFFKIWIVIGLVII
    USA300_FPR3757  QRPITYQHRSDSSVISRWLRYVLIVIGSAALYLGYFIALQQDTTFGAFFKIWIVIGLVII
                    ************************************************************

    COL             GTYAFFVGISEIIISILQQVSKVYYHPRYFFVVVGMRVRLKMNAVSLATITLLCTFLIVT
    N315            GTYAFFVGISEIIISILQQVSKVYYHPRYFFVVVGMRVRLKMNAVSLATITLLCTFLIVT
    NCTC8325        GTYAFFVGISEIIISILQQVSKVYYHPRYFFVVVGMRVRLKMNAVSLATITLLCTFLIVT
    Newman          GTYAFFVGISEIIISILQQVSKVYYHPRYFFVVVGMRVRLKMNAVSLATITLLCTFLIVT
    USA300_FPR3757  GTYAFFVGISEIIISILQQVSKVYYHPRYFFVVVGMRVRLKMNAVSLATITLLCTFLIVT
                    ************************************************************

    COL             LTMTLTTYRDMNHTITKLITNDYDLSFSDNSKSQIERQQTIENIKRDIQGSVNAKDFKVY
    N315            LTMTLTTYRDMNHTITKLITNDYDLSFSDNSKSQIERQQTIENIKRDIQGSVNAKDFKVY
    NCTC8325        LTMTLTTYRDMNHTITKLITNDYDLSFSDNSKSQIERQQTIENIKRDIQGSVNAKDFKVY
    Newman          LTMTLTTYRDMNHTITKLITNDYDLSFSDNSKSQIERQQTIENIKRDIQGSVNAKDFKVY
    USA300_FPR3757  LTMTLTTYRDMNHTITKLITNDYDLSFSDNSKSQIERQQTIENIKRDIQGSVNAKDFKVY
                    ************************************************************

    COL             ETTLFRASLEKNRAYYKLKQASDDIPIDFIGNEGAIFSRQSVMITAFTAQDYNRYHQNKL
    N315            ETTLFRASLEKNRAYYKLKQASDDIPIDFIGNEGAIFSRQSVMITAFTAQDYNRYHQNKL
    NCTC8325        ETTLFRASLEKNRAYYKLKQASDDIPIDFIGNEGAIFSRQSVMITAFTAQDYNRYHQNKL
    Newman          ETTLFRASLEKNRAYYKLKQASDDIPIDFIGNEGAIFSRQSVMITAFTAQDYNRYHQNKL
    USA300_FPR3757  ETTLFRASLEKNRAYYKLKQASDDIPIDFIGNEGAIFSRQSVMITAFTAQDYNRYHQNKL
                    ************************************************************

    COL             HLDNQSIGMITNVPIFKKQSKVGLNNEVFKVKQLDAHALNLMMIQDSMVLIVKDNNQLQK
    N315            HLDNQSIGMITNVPIFKKQSKVGLNNEVFKVKQLDAHALNLMMIQDSMVLIVKDNNQLQK
    NCTC8325        HLDNQSIGMITNVPIFKKQSKVGLNNEVFKVKQLDAHALNLMMIQDSMVLIVKDNNQLQK
    Newman          HLDNQSIGMITNVPIFKKQSKVGLNNEVFKVKQLDAHALNLMMIQDSMVLIVKDNNQLQK
    USA300_FPR3757  HLDNQSIGMITNVPIFKKQSKVGLNNEVFKVKQLDAHALNLMMIQDSMVLIVKDNNQLQK
                    ************************************************************

    COL             VKGFYAHEQKNSTISINFNVFGKTKLTTSQIQKLSKKYDASINSKSEMLMVWDRLTGGLI
    N315            VKGFYAHEQKNSTISINFNVFGKTKLTTSQIQKLSKKYDASINSKSEMLMVWDRLTGGLI
    NCTC8325        VKGFYAHEQKNSTISINFNVFGKTKLTTSQIQKLSKKYDASINSKSEMLMVWDRLTGGLI
    Newman          VKGFYAHEQKNSTISINFNVFGKTKLTTSQIQKLSKKYDASINSKSEMLMVWDRLTGGLI
    USA300_FPR3757  VKGFYAHEQKNSTISINFNVFGKTKLTTSQIQKLSKKYDASINSKSEMLMVWDRLTGGLI
                    ************************************************************

    COL             FVGGVVSIVLVIGIFLMMYYKQVSEAYANQHNYDIMKKLGLDNGRIAKITRNQMTFLFAI
    N315            FVGGVVSIVLVIGIFLMMYYKQVSEAYANQHNYDIMKKLGLDNGRIAKITRNQMTFLFAI
    NCTC8325        FVGGVVSIVLVIGIFLMMYYKQVSEAYANQHNYDIMKKLGLDNGRIAKITRNQMTFLFAI
    Newman          FVGGVVSIVLVIGIFLMMYYKQVSEAYANQHNYDIMKKLGLDNGRIAKITRNQMTFLFAI
    USA300_FPR3757  FVGGVVSIVLVIGIFLMMYYKQVSEAYANQHNYDIMKKLGLDNGRIAKITRNQMTFLFAI
                    ************************************************************

    COL             PITVALIHTLISSNIVYTLLNMIGINNHHIFLTSYVLAVIIISFLYMAMYKITSYIYAKV
    N315            PITVALIHTLISSNIVYTLLNMIGINNHHIFLTSYVLAVIIISFLYMAMYKITSYIYAKV
    NCTC8325        PITVALIHTLISSNIVYTLLNMIGINNHHIFLTSYVLAVIIISFLYMAMYKITSYIYAKV
    Newman          PITVALIHTLISSNIVYTLLNMIGINNHHIFLTSYVLAVIIISFLYMAMYKITSYIYAKV
    USA300_FPR3757  PITVALIHTLISSNIVYTLLNMIGINNHHIFLTSYVLAVIIISFLYMAMYKITSYIYAKV
                    ************************************************************

    COL             IHQQRN
    N315            IHQQRN
    NCTC8325        IHQQRN
    Newman          IHQQRN
    USA300_FPR3757  IHQQRN
                    ******