From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006349000
  • symbol?: phoB
  • description?: alkaline phosphatase

      descriptions from strain specific annotations:

    • alkaline phosphatase
    • alkaline phosphatase III precursor
    • alkaline phosphatase 3 (Alkaline phosphataseIII) (APase III)
    • alkaline phosphatase family protein
    • pseudogene
    • alkaline phosphatase PhoA
    • Alkaline phosphatase III
  • strand?: +
  • coordinates?: 6385946..6388444
  • synteny block?: BlockID0050590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2420 (phoB)
    NCTC8325:
    Newman:
    NWMN_2526 (phoB)
    USA300_FPR3757:
    04-02981:
    SA2981_2566 (phoB)
    08BA02176:
    C248_2694 (phoB)
    11819-97:
    MS7_2632 (phoB)
    71193:
    ST398NM01_2676
    ECT-R 2:
    ECTR2_2481
    ED133:
    SAOV_2675
    ED98:
    SAAV_2695
    HO 5096 0412:
    SAEMRSA15_25310 (phoB)
    JH1:
    SaurJH1_2706
    JH9:
    SaurJH9_2650
    JKD6008:
    SAA6008_02686 (phoA)
    JKD6159:
    SAA6159_02523 (phoA)
    LGA251:
    SARLGA251_23990 (phoB)
    M013:
    M013TW_2606
    MRSA252:
    SAR2706 (phoB)
    MSHR1132:
    SAMSHR1132_24500
    MSSA476:
    SAS2513
    Mu3:
    SAHV_2611 (phoB)
    Mu50:
    SAV2627 (phoB)
    MW2:
    MW2547 (phoB)
    RF122:
    SAB2502 (phoB)
    ST398:
    SAPIG2676
    T0131:
    SAT0131_02890
    TCH60:
    HMPREF0772_10562 (phoB)
    TW20:
    SATW20_27650 (phoB)
    USA300_TCH1516:
    USA300HOU_2626
    VC40:
    SAVC_12010

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
    N315            MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
    NCTC8325        MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
    Newman          MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
    USA300_FPR3757  MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
                    ************************************************************

    COL             GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
    N315            GPSFNTAYRYYKNDSHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
    NCTC8325        GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
    Newman          GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
    USA300_FPR3757  GPSFNTAYRYYKNDPHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
                    **************.*********************************************

    COL             YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
    N315            YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
    NCTC8325        YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
    Newman          YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
    USA300_FPR3757  YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
                    ************************************************************

    COL             FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
    N315            FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKDLSKSDKDKVLGLF
    NCTC8325        FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
    Newman          FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
    USA300_FPR3757  FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKELSKSDKDKVLGLF
                    **********************************************:*************

    COL             ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
    N315            ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
    NCTC8325        ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
    Newman          ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
    USA300_FPR3757  ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
                    ************************************************************

    COL             MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
    N315            MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
    NCTC8325        MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
    Newman          MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
    USA300_FPR3757  MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
                    ************************************************************

    COL             EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSAEVETQTKALQH
    N315            EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLQKLLKKEKDEKSADVEKQTKALQH
    NCTC8325        EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSAEVETQTKALQH
    Newman          EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSAEVETQTKALQH
    USA300_FPR3757  EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLKRLLKKEKDEKSAEVETQTKALQH
                    ************************************::***********:**.*******

    COL             AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
    N315            AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
    NCTC8325        AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
    Newman          AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
    USA300_FPR3757  AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
                    ******************************************************