From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006354000
  • symbol?:
  • description?: MarR family transcriptional regulator

      descriptions from strain specific annotations:

    • MarR family transcriptional regulator
    • transcriptional regulator
    • putative transcriptional regulator
    • HTH domain protein
    • MarR family regulatory protein
    • MW2549 protein
    • putative regulatory protein
    • regulatory protein
    • Transcriptional regulator, MarR family
    • transcriptional regulator, putative
    • transcriptional regulator SlyA
  • strand?: -
  • coordinates?: 6388729..6389184
  • synteny block?: BlockID0050640
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2567
    08BA02176:
    C248_2696
    11819-97:
    MS7_2633
    71193:
    ST398NM01_2677
    ECT-R 2:
    ECTR2_2482
    ED133:
    SAOV_2677c
    ED98:
    SAAV_2697
    HO 5096 0412:
    SAEMRSA15_25330
    JH1:
    SaurJH1_2708
    JH9:
    SaurJH9_2652
    JKD6008:
    SAA6008_02687 (slyA)
    JKD6159:
    SAA6159_02524 (slyA)
    LGA251:
    SARLGA251_24000
    M013:
    MRSA252:
    SAR2707
    MSHR1132:
    SAMSHR1132_24520
    MSSA476:
    SAS2514
    Mu3:
    SAHV_2612
    Mu50:
    SAV2628
    MW2:
    MW2549
    RF122:
    SAB2503c
    ST398:
    SAPIG2677
    T0131:
    SAT0131_02891
    TCH60:
    HMPREF0772_10561
    TW20:
    SATW20_27660
    USA300_TCH1516:
    USA300HOU_2628
    VC40:
    SAVC_12020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ------MSTNKNDYEHMLFYFAYKTFITTADEIIEKYGMSRQHHRFLFFINKLPGITIKS
    N315            MKGVIIMSTNKNDYEHMLFYFAYKTFITTADEIIEKYGMSRQHHRFLFFINKLPGITIKS
    NCTC8325        ------MSTNKNDYEHMLFYFAYKTFITTADEIIEKYGMSRQHHRFLFFINKLPGITIKS
    Newman          ------MSTNKNDYEHMLFYFAYKTFITTADEIIEKYGMSRQHHRFLFFINKLPGITIKS
    USA300_FPR3757  ------MSTNKNDYEHMLFYFAYKTFITTADEIIEKYGMSRQHHRFLFFINKLPGITIKS
                          ******************************************************

    COL             LLEILEISKQGSHATLQKLKEQGLIIEKVLETDRRVKKLYSTDKGDQLIAELNKAQDELL
    N315            LLEILEISKQGSHATLQKLKEQGLIIEKVLETDRRVKKLYSTDKGDQLIAELNKAQDELL
    NCTC8325        LLEILEISKQGSHATLQKLKEQGLIIEKVLETDRRVKKLYSTDKGDQLIAELNKAQDELL
    Newman          LLEILEISKQGSHATLQKLKEQGLIIEKVLETDRRVKKLYSTDKGDQLIAELNKAQDELL
    USA300_FPR3757  LLEILEISKQGSHATLQKLKEQGLIIEKVLETDRRVKKLYSTDKGDQLIAELNKAQDELL
                    ************************************************************

    COL             QNIYQQVGSDWYDVMEALAKGRPGFDFIKHLKDEKES
    N315            QNIYQQVGSDWYDVMEALAKGRPGFDFIKHLKDEKES
    NCTC8325        QNIYQQVGSDWYDVMEALAKGRPGFDFIKHLKDEKES
    Newman          QNIYQQVGSDWYDVMEALAKGRPGFDFIKHLKDEKES
    USA300_FPR3757  QNIYQQVGSDWYDVMEALAKGRPGFDFIKHLKDEKES
                    *************************************