From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006357000
  • symbol?: clfB
  • description?: clumping factor B

      descriptions from strain specific annotations:

    • clumping factor B
    • Clumping factor ClfB, fibrinogen binding protein
    • LPXTG-motif cell wall anchor domain-containing protein
    • clumping factor B precursor
    • fibrinogen and keratin-10 binding surface anchored protein
    • clumping factor B (Fibrinogen-binding protein B) (Fibrinogenreceptor B)
    • fibrinogen and keratin-10 binding surfaced anchored protein
  • strand?: -
  • coordinates?: 6390350..6394268
  • synteny block?: BlockID0050660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2652 (clfB)
    N315:
    SA2423 (clfB)
    NCTC8325:
    Newman:
    NWMN_2529 (clfB)
    USA300_FPR3757:
    04-02981:
    SA2981_2569 (clfB)
    08BA02176:
    C248_2698 (clfB)
    11819-97:
    MS7_2635 (clfB)
    71193:
    ST398NM01_2679
    ECT-R 2:
    ECTR2_2484
    ED133:
    SAOV_2679c (clfB)
    ED98:
    SAAV_2699 (clfB)
    HO 5096 0412:
    SAEMRSA15_25350 (clfB)
    JH1:
    SaurJH1_2710
    JH9:
    SaurJH9_2654
    JKD6008:
    SAA6008_02689 (clfB)
    JKD6159:
    SAA6159_02526 (clfB)
    LGA251:
    SARLGA251_24020 (clfB)
    M013:
    M013TW_2611
    MRSA252:
    SAR2709 (clfB)
    MSHR1132:
    SAMSHR1132_24540
    MSSA476:
    SAS2516
    Mu3:
    SAHV_2614 (clfB)
    Mu50:
    SAV2630 (clfB)
    MW2:
    MW2551 (clfB)
    RF122:
    SAB2505c (clfB)
    ST398:
    SAPIG2679
    T0131:
    SAT0131_02896 (dapA)
    TCH60:
    HMPREF0772_10559 (clfB)
    TW20:
    SATW20_27680 (clfB)
    USA300_TCH1516:
    USA300HOU_2630 (clfB)
    VC40:
    SAVC_12030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSNDTTQSSKNNAS
    N315            MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSNDTTQSSKNNAS
    NCTC8325        MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSNDTTQSSKNNAS
    Newman          MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSNDTTQSSKNNAS
    USA300_FPR3757  MKKRIDYLSNKQNKYSIRRFTVGTTSVIVGATILFGIGNHQAQASEQSNDTTQSSKNNAS
                    ************************************************************

    COL             ADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTTKPMSTQTSNTTTTEPASTNETPQ
    N315            ADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTTKPMSTQTSNTTTTEPASTNETPQ
    NCTC8325        ADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTTKPMSTQTSNTTTTEPASTNETPQ
    Newman          ADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTTKPMSTQTSNTTTTEPASTNETPQ
    USA300_FPR3757  ADSEKNNMIETPQLNTTANDTSDISANTNSANVDSTTKPMSTQTSNTTTTEPASTNETPQ
                    ************************************************************

    COL             PTAIKNQATAAKMQDQTVPQEANSQVDNKTTNDANSIATNSELKNSQTLDLPQSSPQTIS
    N315            PTAIKNQATAAKMQDQTVPQEANSQVDNKTTNDANSIATNSELKNSQTLDLPQSSPQTIS
    NCTC8325        PTAIKNQATAAKMQDQTVPQEANSQVDNKTTNDANSIATNSELKNSQTLDLPQSSPQTIS
    Newman          PTAIKNQATAAKMQDQTVPQEANSQVDNKTTNDANSIATNSELKNSQTLDLPQSSPQTIS
    USA300_FPR3757  PTAIKNQATAAKMQDQTVPQEANSQVDNKTTNDANSIATNSELKNSQTLDLPQSSPQTIS
                    ************************************************************

    COL             NAQGTSKPSVRTRAVRSLAVAEPVVNAADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTF
    N315            NAQGTSKPSVRTRAVRSLAVAEPVVNAADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTF
    NCTC8325        NAQGTSKPSVRTRAVRSLAVAEPVVNAADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTF
    Newman          NAQGTSKPSVRTRAVRSLAVAEPVVNAADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTF
    USA300_FPR3757  NAQGTSKPSVRTRAVRSLAVAEPVVNAADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTF
                    ************************************************************

    COL             MAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDI
    N315            MAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDI
    NCTC8325        MAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDI
    Newman          MAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDI
    USA300_FPR3757  MAANFTVTDKVKSGDYFTAKLPDSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDI
                    ************************************************************

    COL             LTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYS
    N315            LTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYS
    NCTC8325        LTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYS
    Newman          LTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYS
    USA300_FPR3757  LTKTYTFVFTDYVNNKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYS
                    ************************************************************

    COL             SPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEES
    N315            SPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEES
    NCTC8325        SPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEES
    Newman          SPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEES
    USA300_FPR3757  SPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEES
                    ************************************************************

    COL             SGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGD
    N315            SGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGD
    NCTC8325        SGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGD
    Newman          SGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGD
    USA300_FPR3757  SGKVSATDTKLRIFEVNDISKLSDSYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGD
                    ****************** *****************************************

    COL             ITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSA
    N315            ITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSA
    NCTC8325        ITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSA
    Newman          ITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSA
    USA300_FPR3757  ITKTYVVLVEGHYDNTGKNLKTQVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSA
                    ************************************************************

    COL             VNPKDPTPGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSGSDSDSGS
    N315            VNPKDPTPGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSGSDSDSGS
    NCTC8325        VNPKDPTPGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSGSDSDSGS
    Newman          VNPKDPTPGPPVDPEPSPDPEPEPTPDPEPSPDPEPEPSPDPDPDSDSDSDSGSDSDSGS
    USA300_FPR3757  VNPKDPTPGPPV--------------DPEPSPDPEPEPSPDPDPDSDSDSDSGSDSDSGS
                    ************              **********************************

    COL             DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    N315            DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSD---------------------
    NCTC8325        DSDSESDSDSDSDSDSDSDSDSESDSDSESDSESDSDSD---------------------
    Newman          DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    USA300_FPR3757  DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
                    ********************************:******                     

    COL             DSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    N315            ---------------SDSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDS
    NCTC8325        ---------------SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    Newman          DSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    USA300_FPR3757  DSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
                                   *******:*****************:*****:***:*********

    COL             DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    N315            DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    NCTC8325        DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    Newman          DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    USA300_FPR3757  DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
                    ****************************:*******************************

    COL             DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    N315            DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    NCTC8325        DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    Newman          DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
    USA300_FPR3757  DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
                    ************************************************************

    COL             RVTPPNNEQKAPSNPKGEVNHSNKVSKQHKTDALPETGDKSENTNATLFGAMMALLGSLL
    N315            RVTPPNNEQKAPSNPKGEVNHSNKVSKQHKTDALPETGDKSENTNATLFGAMMALLGSLL
    NCTC8325        RVTPPNNEQKAPSNPKGEVNHSNKVSKQHKTDALPETGDKSENTNATLFGAMMALLGSLL
    Newman          RVTPPNNEQKAPSNPKGEVNHSNKVSKQHKTDALPETGDKSENTNATLFGAMMALLGSLL
    USA300_FPR3757  RVTPPNNEQKAPSNPKGEVNHSNKVSKQHKTDALPETGDKSENTNATLFGAMMALLGSLL
                    ************************************************************

    COL             LFRKRKQDHKEKA
    N315            LFRKRKQDHKEKA
    NCTC8325        LFRKRKQDHKEKA
    Newman          LFRKRKQDHKEKA
    USA300_FPR3757  LFRKRKQDHKEKA
                    *************