From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006361000
  • symbol?: arcC
  • description?: carbamate kinase

      descriptions from strain specific annotations:

    • carbamate kinase
    • carbamate kinase 2
  • strand?: -
  • coordinates?: 6395426..6396367
  • synteny block?: BlockID0050700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2654 (arcC2)
    N315:
    SA2425 (arcC)
    NCTC8325:
    Newman:
    NWMN_2531 (arcC)
    USA300_FPR3757:
    04-02981:
    SA2981_2571 (arcC)
    08BA02176:
    C248_2700 (arcC)
    11819-97:
    MS7_2637
    71193:
    ST398NM01_2682
    ECT-R 2:
    ECTR2_2486 (arcC)
    ED133:
    SAOV_2681c
    ED98:
    SAAV_2701 (arcC2)
    HO 5096 0412:
    SAEMRSA15_25370 (arcC)
    JH1:
    SaurJH1_2712
    JH9:
    SaurJH9_2656
    JKD6008:
    SAA6008_02691 (arcC)
    JKD6159:
    SAA6159_02528 (arcC)
    LGA251:
    SARLGA251_24040 (arcC)
    M013:
    M013TW_2613
    MRSA252:
    SAR2711 (arcC)
    MSHR1132:
    SAMSHR1132_24560
    MSSA476:
    SAS2518
    Mu3:
    SAHV_2616 (arcC)
    Mu50:
    SAV2632 (arcC)
    MW2:
    MW2553 (arcC)
    RF122:
    SAB2507c (arcC)
    ST398:
    SAPIG2682 (arcC)
    T0131:
    SAT0131_02898 (dapD)
    TCH60:
    HMPREF0772_10556 (arcC)
    TW20:
    SATW20_27700 (arcC)
    USA300_TCH1516:
    USA300HOU_2632 (arcC3)
    VC40:
    SAVC_12040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------MKEKIVIALGGNAIQTTEATAEAQQTAIRCAMQNLKPLFDSPARIVISHGN
    N315            ---------MKEKIVIALGGNAIQTKEATAEAQQTAIRRAMQNLKPLFDSPARIVISHGN
    NCTC8325        ---------MKEKIVIALGGNAIQTTEATAEAQQTAIRCAMQNLKPLFDSPARIVISHGN
    Newman          MFFKRSDKNMKEKIVIALGGNAIQTTEATAEAQQTAIRCAMQNLKPLFDSPARIVISHGN
    USA300_FPR3757  ---------MKEKIVIALGGNAIQTTEATAEAQQTAIRCAMQNLKPLFDSPARIVISHGN
                             ****************.************ *********************

    COL             GPQIGSLLIQQAKSNSDTTPAMPLDTCGAMSQGMIGYWLETEINRILTEMNSDRTVGTIV
    N315            GPQIGSLLIQQAKSNSDTTPAMPLDTCGAMSQGMIGYWLETEINRILTEMNSDRTVGTIV
    NCTC8325        GPQIGSLLIQQAKSNSDTTPAMPLDTCGAMSQGMIGYWLETEINRILTEMNSDRTVGTIV
    Newman          GPQIGSLLIQQAKSNSDTTPAMPLDTCGAMSQGMIGYWLETEINRILTEMNSDRTVGTIV
    USA300_FPR3757  GPQIGSLLIQQAKSNSDTTPAMPLDTCGAMSQGMIGYWLETEINRILTEMNSDRTVGTIV
                    ************************************************************

    COL             TRVEVDKDDPRFDNPTKPIGPFYTKEEVEELQKEQPDSVFKEDAGRGYRKVVASPLPQSI
    N315            TRVEVDKDDPRFNNPTKPIGPFYTKEEVEELQKEQPDSVFKEDAGRGYRKVVASPLPQSI
    NCTC8325        TRVEVDKDDPRFDNPTKPIGPFYTKEEVEELQKEQPDSVFKEDAGRGYRKVVASPLPQSI
    Newman          TRVEVDKDDPRFDNPTKPIGPFYTKEEVEELQKEQPDSVFKEDAGRGYRKVVASPLPQSI
    USA300_FPR3757  TRVEVDKDDPRFDNPTKPIGPFYTKEEVEELQKEQPDSVFKEDAGRGYRKVVASPLPQSI
                    ************:***********************************************

    COL             LEHQLIRTLADGKNIVIACGGGGIPVIKKENTYEGVEAVIDKDFASEKLATLIEADTLMI
    N315            LEHQLIRTLADGKNIVIACGGGGIPVIKKENTYEGVEAVIDKDFASEKLATLIEADTLMI
    NCTC8325        LEHQLIRTLADGKNIVIACGGGGIPVIKKENTYEGVEAVIDKDFASEKLATLIEADTLMI
    Newman          LEHQLIRTLADGKNIVIACGGGGIPVIKKENTYEGVEAVIDKDFASEKLATLIEADTLMI
    USA300_FPR3757  LEHQLIRTLADGKNIVIACGGGGIPVIKKENTYEGVEAVIDKDFASEKLATLIEADTLMI
                    ************************************************************

    COL             LTNVENVFINFNEPNQQQIDDIDVATLKKYAAQGKFVEGSMLPKIEAAIRFVESGENKKV
    N315            LTNVENVFINFNEPNQQQIDDIDVATLKKYAAQGKFAEGSMLPKIEAAIRFVESGENKKV
    NCTC8325        LTNVENVFINFNEPNQQQIDDIDVATLKKYAAQGKFVEGSMLPKIEAAIRFVESGENKKV
    Newman          LTNVENVFINFNEPNQQQIDDIDVATLKKYAAQGKFVEGSMLPKIEAAIRFVESGENKKV
    USA300_FPR3757  LTNVENVFINFNEPNQQQIDDIDVATLKKYAAQGKFVEGSMLPKIEAAIRFVESGENKKV
                    ************************************.***********************

    COL             IITNLEQAYEALIGNKGTHIHM
    N315            IITNLEQAYEALIGNKGTHIHM
    NCTC8325        IITNLEQAYEALIGNKGTHIHM
    Newman          IITNLEQAYEALIGNKGTHIHM
    USA300_FPR3757  IITNLEQAYEALIGNKGTHIHM
                    **********************