From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006367000
  • symbol?: aur
  • description?: zinc metalloproteinase aureolysin

      descriptions from strain specific annotations:

    • zinc metalloproteinase aureolysin
    • peptidase M4 family protein
    • Zinc metalloproteinase precursor / aureolysin
    • Aureolysin
    • aureolysin, fungalysin/thermolysin metalloproteinase precursor
    • zinc metalloproteinase aureolysin (Staphylococcus aureus neutral proteinase)
    • zinc metalloproteinase aureolysin (Staphylococcus aureus subsp. aureus ECT-R 2 neutral proteinase)
    • zinc metalloproteinase aureolysin precursor
  • strand?: -
  • coordinates?: 6401360..6402856
  • synteny block?: BlockID0050760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2659 (aur)
    N315:
    SA2430 (aur)
    NCTC8325:
    Newman:
    NWMN_2536 (aur)
    USA300_FPR3757:
    04-02981:
    SA2981_2576 (aur)
    08BA02176:
    C248_2705 (aur)
    11819-97:
    MS7_2642 (aur)
    71193:
    ST398NM01_2687
    ECT-R 2:
    ECTR2_2491
    ED133:
    SAOV_2686c
    ED98:
    SAAV_2706 (aur)
    HO 5096 0412:
    SAEMRSA15_25420 (aur)
    JH1:
    SaurJH1_2717
    JH9:
    SaurJH9_2661
    JKD6008:
    SAA6008_02696 (aur)
    JKD6159:
    SAA6159_02533 (aur)
    LGA251:
    SARLGA251_24090 (aur)
    M013:
    M013TW_2618
    MRSA252:
    SAR2716 (aur)
    MSHR1132:
    SAMSHR1132_24610
    MSSA476:
    SAS2523
    Mu3:
    SAHV_2621 (aur)
    Mu50:
    SAV2637 (aur)
    MW2:
    MW2558 (aur)
    RF122:
    SAB2512c (aur)
    ST398:
    SAPIG2687
    T0131:
    SAT0131_02903 (cspA)
    TCH60:
    HMPREF0772_10550 (aur)
    TW20:
    SATW20_27750 (aur)
    USA300_TCH1516:
    USA300HOU_2637 (aur)
    VC40:
    SAVC_12065

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRKFSRYAFTSMAALTLLSTLSPAALAIDSKNKPANSDIKFEVTQKSDAVKALKELPKSE
    N315            MRKFSRYAFTSMAAVTLLSTLSPAALAIDSKNKPANSDIKFEVTQKSDAVKALKELPKSE
    NCTC8325        -----------MAALTLLSTLSPAALAIDSKNKPANSDIKFEVTQKSDAVKALKELPKSE
    Newman          MRKFSRYAFTSMAALTLLSTLSPAALAIDSKNKPANSDIKFEVTQKSDAVKALKELPKSE
    USA300_FPR3757  MRKFSRYAFTSMAALTLLSTLSPAALAIDSKNKPANSDIKFEVTQKSDAVKALKELPKSE
                               ***:*********************************************

    COL             NVKNIYQDYAVTDVKTDKKGFTHYTLQPSVDGVHAPDKEVKVHADKSGKVVLINGDTDAK
    N315            NVKNIYQDYAVTDVKTDKKGFTHYTLQPSVDGVHAPDKEVKVHADKSGKVVLINGDTDAK
    NCTC8325        NVKNIYQDYAVTDVKTDKKGFTHYTLQPSVDGVHAPDKEVKVHADKSGKVVLINGDTDAK
    Newman          NVKNIYQDYAVTDVKTDKKGFTHYTLQPSVDGVHAPDKEVKVHADKSGKVVLINGDTDAK
    USA300_FPR3757  NVKNIYQDYAVTDVKTDKKGFTHYTLQPSVDGVHAPDKEVKVHADKSGKVVLINGDTDAK
                    ************************************************************

    COL             KVKPTNKVTLSKDDAADKAFKAVKIDKNKAKNLKDKVIKENKVEIDGDSNKYVYNVELIT
    N315            KVKPTNKVTLSKDDAADKAFKAVKIDKHKAKNLKDKVIKENKVEIDGDSNKYVYNVELIT
    NCTC8325        KVKPTNKVTLSKDDAADKAFKAVKIDKNKAKNLKDKVIKENKVEIDGDSNKYVYNVELIT
    Newman          KVKPTNKVTLSKDDAADKAFKAVKIDKNKAKNLKDKVIKENKVEIDGDSNKYVYNVELIT
    USA300_FPR3757  KVKPTNKVTLSKDDAADKAFKAVKIDKNKAKNLKDKVIKENKVEIDGDSNKYVYNVELIT
                    ***************************:********************************

    COL             VTPEISHWKVKIDAQTGEILEKMNLVKEAAETGKGKGVLGDTKDININSIDGGFSLEDLT
    N315            VTPEISHWKVKIDAQTGEILEKMNLVKEAAETGKGKGVLGDTKDININSIDGGFSLEDLT
    NCTC8325        VTPEISHWKVKIDAQTGEILEKMNLVKEAAETGKGKGVLGDTKDININSIDGGFSLEDLT
    Newman          VTPEISHWKVKIDAQTGEILEKMNLVKEAAETGKGKGVLGDTKDININSIDGGFSLEDLT
    USA300_FPR3757  VTPEISHWKVKIDAQTGEILEKMNLVKEAAETGKGKGVLGDTKDININSIDGGFSLEDLT
                    ************************************************************

    COL             HQGKLSAFSFNDQTGQATLITNEDENFVKDEQRAGVDANYYAKQTYDYYKDTFGRESYDN
    N315            HQGKLSAFSFNDQTGQATLITNEDENFVKDEQRAGVDANYYAKQTYDYYKDTFGRESYDN
    NCTC8325        HQGKLSAFSFNDQTGQATLITNEDENFVKDEQRAGVDANYYAKQTYDYYKDTFGRESYDN
    Newman          HQGKLSAFSFNDQTGQATLITNEDENFVKDEQRAGVDANYYAKQTYDYYKDTFGRESYDN
    USA300_FPR3757  HQGKLSAFSFNDQTGQATLITNEDENFVKDEQRAGVDANYYAKQTYDYYKDTFGRESYDN
                    ************************************************************

    COL             QGSPIVSLTHVNNYGGQDNRNNAAWIGDKMIYGDGDGRTFTSLSGANDVVAHELTHGVTQ
    N315            QGSPIVSLTHVNNYGGQDNRNNAAWIGDKMIYGDGDGRTFTSLSGANDVVAHELTHGVTQ
    NCTC8325        QGSPIVSLTHVNNYGGQDNRNNAAWIGDKMIYGDGDGRTFTSLSGANDVVAHELTHGVTQ
    Newman          QGSPIVSLTHVNNYGGQDNRNNAAWIGDKMIYGDGDGRTFTSLSGANDVVAHELTHGVTQ
    USA300_FPR3757  QGSPIVSLTHVNNYGGQDNRNNAAWIGDKMIYGDGDGRTFTSLSGANDVVAHELTHGVTQ
                    ************************************************************

    COL             ETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPA
    N315            ETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPA
    NCTC8325        ETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPA
    Newman          ETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPA
    USA300_FPR3757  ETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPA
                    ************************************************************

    COL             HMKDYVFTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCK
    N315            HMKDYVFTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCK
    NCTC8325        HMKDYVFTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCK
    Newman          HMKDYVFTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCK
    USA300_FPR3757  HMKDYVFTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCK
                    ************************************************************

    COL             DALYQAAKDLYDEQTAEQVYEAWNEVGVE
    N315            DALYQAAKDLYDEQTAEQVYEAWNEVGVE
    NCTC8325        DALYQAAKDLYDEQTAEQVYEAWNEVGVE
    Newman          DALYQAAKDLYDEQTAEQVYEAWNEVGVE
    USA300_FPR3757  DALYQAAKDLYDEQTAEQVYEAWNEVGVE
                    *****************************